| request information: |
|
| Catalog Code: | H00000034-A01 |
| Product Name: | ACADM Antibody |
| Product Description: | Mouse Polyclonal anti-ACADM |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 34 |
| Gene Symbol: | ACADM |
| Omim ID: | 201450 607008 |
| Immunogen: | ACADM (NP_000007, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIR
RAWELGLMNTHIPENCGGLGL* |
| Specificity: | ACADM - acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | This gene encodes the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Defects in this gene cause medium-chain acyl-CoA dehydrogenase deficiency, a disease characterized by hepatic dysfunction, fasting hypoglycemia, and encephalopathy, which can result in infantile death. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ABR antibody, anti-active BCR-related gene antibody, anti-MDB antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
| Product References: | 1. Rennison JH, McElfresh TA, Okere IC, Patel HV, et al. Enhanced acyl-CoA dehydrogenase activity is associated with improved mitochondrial and contractile function in heart failure. Cardiovasc Res. 2008 Apr 10 |
order or
more information: | company product webpage |