ExactAntigen

ABL2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000027-M09
Product Type:Primary Antibody
Product Name:ABL2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:27
Host:Mouse
Clone:5C6
Isotype:IgG3 Kappa
Product Description:Mouse Monoclonal anti-ABL2 (5C6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The gene product is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. This gene is expressed
Alternate Names:anti-ABLL antibody, anti-ARG antibody
Immunogen:ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag.
Epitope:KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ABL2
Omim ID:164690,
see all human ABL2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about