ExactAntigen

ABL2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000027-M06
Product Type:Primary Antibody
Product Name:ABL2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:27
Host:Mouse
Clone:2H8
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-ABL2 (2H8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 7-10. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.PLEASE NOTE - This product originates in Taiwan. If in stock
Alternate Names:anti-ABLL antibody, anti-ARG antibody
Immunogen:ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag.
Epitope:KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug purified IgG
Package Size:100 ug
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ABL2
Omim ID:164690,
see all human ABL2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about