ExactAntigen

Mouse Monoclonal anti-ABL2 (3D2)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00000027-M05
ProductName:ABL2 Antibody
Product Description:Mouse Monoclonal anti-ABL2 (3D2)
Clone:3D2
Clonality:Monoclonal
Immunogen:ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag.
Epitope:KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:The gene product is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. This gene is expressed in both normal and tumor cells. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-ABLL antibody, anti-ARG antibody
ProteinTarget:v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:27
Gene_Symbol:ABL2
Omim_ID:164690,
see all human ABL2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about