| request information: |
|
| Catalog Code: | H00000027-M03 |
| Product Name: | ABL2 Antibody |
| Product Description: | Mouse Monoclonal anti-ABL2 (6D5) |
| Clone: | 6D5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 27 |
| Gene Symbol: | ABL2 |
| Omim ID: | 164690, |
| Immunogen: | ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. |
| Epitope: | KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKK
SEESAAPSRERPKAKLLPRGA |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Background: | The gene product is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. This gene is expressed in both normal and tumor cells. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot, RNAi Validation |
| Species Summary: | Hu |
| Alternate Names: | anti-ABLL antibody, anti-ARG antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |