ExactAntigen

amiloride binding protein 1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000026-A01
Product Type:Primary Antibody
Product Name:amiloride binding protein 1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:26
Host:Mouse
Product Description:Mouse Polyclonal anti-amiloride binding protein 1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in th
Alternate Names:anti-ABP antibody, anti-AOC1 antibody, anti-DAO antibody, anti-DAO1 antibody, anti-KAO antibody
Immunogen:ABP1 (NP_001082, 501 a.a. ~ 600 a.a) partial recombinant protein with GST tag.
Epitope:LHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHS* ...
Specificity:amiloride binding protein 1 (amine oxidase (copper-containing))
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther appl
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug).
Gene Symbol:ABP1
Omim ID:104610,
see all human ABP1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about