| request information: |
|
| Catalog Code: | H00000024-A01 |
| Product Name: | ABCA4 Antibody |
| Product Description: | Mouse Polyclonal anti-ABCA4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 24 |
| Gene Symbol: | ABCA4 |
| Omim ID: | 153800 248200 601691 601718 |
| Immunogen: | ABCA4 (NP_000341, 2174 a.a. ~ 2274 a.a) partial recombinant protein with GST tag. |
| Epitope: | PKDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQ
TESHDLPLHPRAAGASRQAQD* |
| Specificity: | ABCA4 - ATP-binding cassette, sub-family A (ABC1), member 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is a retina-specific ABC transporter with N-retinylidene-PE as a substrate. It is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Mutations in this gene are found in patients diagnosed with Stargardt disease, a form of juvenile-onset macular degeneration. Mutations in this gene are also associated with retinitis pigmentosa-19, cone-rod dystrophy type 3, early-onset severe retinal dystrophy, fundus flavimaculatus, and macular degeneration age-related 2. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ABC10 antibody, anti-ABCR antibody, anti-DKFZp781N1972 antibody, anti-FFM antibody, anti-RMP antibody, anti-RP19 antibody, anti-STGD antibody, anti-STGD1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |