| request information: |
|
| Catalog Code: | H00000023-A01 |
| Product Name: | ABCF1 Antibody |
| Product Description: | Mouse Polyclonal anti-ABCF1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 23 |
| Gene Symbol: | ABCF1 |
| Omim ID: | 603429, |
| Immunogen: | ABCF1 (NP_001081, 642 a.a. ~ 740 a.a) partial recombinant protein with GST tag. |
| Epitope: | GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELAC
REPDVLILDEPTNNLDIES* |
| Specificity: | ABCF1 - ATP-binding cassette, sub-family F (GCN20), member 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ABC27 antibody, anti-ABC50 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |