| Catalog Code: | H00000013-M01 |
| Product Type: | Primary Antibody |
| Product Name: | arylacetamide deacetylase Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 13 |
| Host: | Mouse |
| Clone: | 2E8 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-arylacetamide deacetylase (2E8) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Genbank acession number is NM_001086. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.Microsomal ary |
| Alternate Names: | anti-DAC antibody |
| Immunogen: | AADAC (NP_001077, 201 a.a. ~ 301 a.a) partial recombinant protein with GST tag. |
| Epitope: | QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP* ... |
| Specificity: | arylacetamide deacetylase (esterase) |
| Purity: | IgG purified |
| Buffer: | 1X PBS pH 7.2 |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug). |
| Gene Symbol: | AADAC |
| Omim ID: | 600338, |