ExactAntigen

arylacetamide deacetylase Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000013-M01
Product Type:Primary Antibody
Product Name:arylacetamide deacetylase Antibody
List Price:275
Clonality:Monoclonal
Gene ID:13
Host:Mouse
Clone:2E8
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-arylacetamide deacetylase (2E8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Genbank acession number is NM_001086. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.Microsomal ary
Alternate Names:anti-DAC antibody
Immunogen:AADAC (NP_001077, 201 a.a. ~ 301 a.a) partial recombinant protein with GST tag.
Epitope:QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP* ...
Specificity:arylacetamide deacetylase (esterase)
Purity:IgG purified
Buffer:1X PBS pH 7.2
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug).
Gene Symbol:AADAC
Omim ID:600338,
see all human AADAC antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about