| request information: |
|
| Catalog Code: | H00000012-M01 |
| Product Name: | SERPINA3 Antibody |
| Product Description: | Mouse Monoclonal anti-SERPINA3 (1E6) |
| Clone: | 1E6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 12 |
| Gene Symbol: | SERPINA3 |
| Omim ID: | 107280, |
| Immunogen: | SERPINA3 (AAH03559, 25 a.a. ~ 424 a.a) full length recombinant protein with GST tag. |
| Epitope: | PNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGL
KFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLIND
YVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSC
TVVELKYTGNASALFILP |
| Specificity: | SERPINA3 - serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | The protein encoded by this gene is a plasma protease inhibitor and member of the serine protease inhibitor class. Polymorphisms in this protein appear to be tissue specific and influence protease targeting. Variations in this protein's sequence have been implicated in Alzheimer's disease, and deficiency of this protein has been associated with liver disease. Mutations have been identified in patients with Parkinson disease and chronic obstructive pulmonary disease. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AACT antibody, anti-ACT antibody, anti-GIG24 antibody, anti-GIG25 antibody, anti-MGC88254 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |