| request information: |
|
| Catalog Code: | H00000001-M15 |
| Product Name: | A1BG Antibody |
| Product Description: | Mouse Monoclonal anti-A1BG (1H1) |
| Clone: | 1H1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 1 |
| Gene Symbol: | A1BG |
| Omim ID: | 138670, |
| Immunogen: | A1BG (AAH35719, 1 a.a. ~ 374 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTI
EELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVDFQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCR
YRLHDNQNGWSGDSAPVELILSDETLPAPEFSPEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALF
ELHNISVADSANYSCVYV |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-A1B antibody, anti-ABG antibody, anti-DKFZp686F0970 antibody, anti-GAB antibody, anti-HYST2477 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |