| AntibodyID: | 38764 |
| AntibodyName: | LS-C39256 |
| LSBioLink: | www.lsbio.com/Products/Antibodies ... |
| TargetSpecies: | Human |
| HostSpecies: | Rabbit |
| ProductName: | Signal Transducer And Activator Of Transcription 1, 91kDa (STAT1) Rabbit anti-Human Polyclonal Antibody |
| EpitopeDesc: | A 39 residue synthetic peptide VHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV based on the |
| ClonalityDesc: | Polyclonal |
| PresentationDesc: | PBS, pH 7.2, containing 0.02% sodium azide. Supplied as an IgG fraction |
| ImmunogenDesc: | Synthetic peptide |
| PurificationDesc: | Highly purified |
| Gene: | Signal Transducer And Activator Of Transcription 1, 91kDa (STAT1) |
| StandardGeneSymbol: | STAT1 |
| Reactivity: | Bovine, Human, Mouse, Rat |
| Usage: | WB, IP |
| Synonyms: | STAT1, DKFZP686B04100, ISGF-3, STAT91 |
| SwissProtProtoID: | P42224 |
|