| AntibodyID: | 24316 |
| AntibodyName: | LS-C23734 |
| LSBioLink: | www.lsbio.com/Products/Antibodies ... |
| TargetSpecies: | Human |
| HostSpecies: | Rabbit |
| ProductName: | GRB2-associated Binding Protein 1 (GAB1) Rabbit anti-Human Polyclonal Antibody |
| EpitopeDesc: | 31 residue peptide sequence corresponding to C-terminal residues 664-694 of Gab1, (CQKTLALKSTREAWTDGRQSTESETPAKS-VK) |
| ClonalityDesc: | Polyclonal |
| PresentationDesc: | 0.1M Tris-glycine, pH 7.4, 0.15M NaCl, 0.05% sodium azide |
| ImmunogenDesc: | Synthetic peptide |
| PurificationDesc: | Protein A column |
| IsotypeName: | IgG |
| Gene: | GRB2-associated Binding Protein 1 (GAB1) |
| StandardGeneSymbol: | GAB1 |
| Reactivity: | Human, Mouse, Rat |
| Usage: | ICC, WB, IP |
| Synonyms: | GAB1 |
| SwissProtProtoID: | Q13480 |
|