| request information: |
|
| AntibodyID: | 11123 |
| AntibodyName: | LS-C10382 |
| TargetSpecies: | Human |
| HostSpecies: | Rabbit |
| ProductName: | Signal Transducer And Activator Of Transcription 3 (Acute-Phase Response Factor) (STAT3) Rabbit anti-Human Polyclonal Antibody |
| Specificity: | Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species Cross-reactivity: Human, rat and mouse |
| ClonalityDesc: | Polyclonal |
| PresentationDesc: | 0.1M Tris-glycine, pH 7.4, 0.15M sodium chloride, 0.05% sodium azide, before the addition of glycerol to 40% |
| ImmunogenType: | Fusion protein |
| ImmunogenDesc: | Bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. |
| PurificationDesc: | Affinity Chromatography |
| RecommendedStorageDesc: | Long term: -20°C; Short term: +4°C |
| IsotypeName: | IgG |
| Gene: | Signal Transducer And Activator Of Transcription 3 (Acute-Phase Response Factor) (STAT3) |
| StandardGeneSymbol: | STAT3 |
| Reactivity: | Human, Mouse, Rat |
| Usage: | ICC, WB, IP |
| Synonyms: | STAT3, APRF, FLJ20882, MGC16063 |
| SwissProtProtoID: | P40763 |
order or
more information: | company product webpage |
|