| Webpages from suppliers |
rndsystems PP2A, also known as PPP2CA and Lot Number: UCN02 PP2CA, is a serine/threonine phosphatase. www.rndsystems.com/pdf/MAB16531.pdf more from same supplier |
abgent --- PPP2CA/B Antibody (C-term) Blocking Peptide to generate the antibody AP8462b was selected from the C-term region of human PPP2CA/B. A 10 to 100 fold molar excess to antibody is recommended. .. Serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform;PP2A-alpha; Replication protein C; RP-C; PPP2CA www.abgent.com/products/catalog_no/BP8462b/specification more from same supplier |
ptglab --- Antibody to PPP2CA PROTEIN PHOSPHATASE 2, CATALYTIC SUBUNIT, ALPHA ISOFORM; PPP2CA .. Purified Rabbit Anti Human PPP2CA Poly antibody www.ptglab.com/datasheet.asp?catNo=13482-1-AP more from same supplier |
biotrend --- Protein Phosphatase 2C, His-taging, (His-PP2Ca), Human Protein Phosphatase 2C, His-taging, (His-PP2Ca), Human .. Antigen, Recombinant >95% Pure www.biotrend.com/search/?search_text=PPC3051 more from same supplier |
gentaur MATP1051 .. PP2Ca, anti-human .. PPP2CA www.gentaur.com/complete_pricelist.php?alf=P&page=41 |
assaypro PPC30011 .. His-PP2Ca(His-taging Protein phosphatase 2C), Human, Recombinant .. PPC30012 www.assaypro.com/antigen_pk.asp |
natutec com www.natutec.de Königslacher Strasse 15-21 60528 Frankfurt am Main PP2Ca Human Protein Phosphatase 2C alpha Human Recombinant Catalog No. .. Amino Acid Sequence: MRGSHGMASMTGGQQMGRDLYDKDRWILMGAFLDKPKMEKHN www.natutec.de/pdf_labgen/110-222.pdf |
exalpha subunit of MEG-1 or protein phosphatase 4 (PP4C) is SIZE 10 µg 65% identical to PP2AC at the amino acid level and has been STORAGE CUSTOMER placed in the type 2A family of .. REFERENCES [1] Kloeker S., Wadzinski B.E. www.exalpha.com/pdfs/X1661E.pdf |
europa-bioproducts Tech Info: PP2Ca www.europa-bioproducts.com/products/251581 |
abnova MGC9201, PP2CALPHA, PP2CA .. protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform www.abnova.com/Products/Products_Detail.asp?Catalog_id=H00005494-B01&PageID=6&classid=&Own ... more from same supplier |
crpinc b>PP2A Alpha Subunit (6F9) Monoclonal Antibody .. Cat No. MRT-204R store.crpinc.com/datasheet.aspx?Catalogno=PRB-527P |
panomics b>PPP2CA .. Protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform www.panomics.com/index.php?id=qgpsc&page=150 more from same supplier |
antibodyresearch b>PP2Ca; Protein phosphatase 2C alpha .. PSPH; Phosphoserine Phosphatase www.antibodyresearch.com/files/proteins_phosphatase.html |
genwaybio Interacts with serine/threonine protein phosphatase 2A catalytic subunit, PPP2CA or PPP2CB. .. Subcellular Location: Cytoplasm (By similarity). Nucleus (By similarity). www.genwaybio.com/product_info.php?cPath=3000_3002&products_id=55020 more from same supplier |