| Webpages from suppliers |
rndsystems
Recombinant Mouse 5'-Nucleotidase/CD73 Catalog Number: 4488-EN Lot Number: QTY0108051 Specifications and Use Source .. 5 2 Recombinant mouse CD73 (R D Systems, Catalog # 4488-EN ) Substrate: AMP (Sigma, Catalog # A1752), 10 mM stock in diH O 2 Malachite Green
www.rndsystems.com/pdf/4488-EN.pdf more from same supplier |
abgent --- NT5E Antibody (N-term)
Western blot analysis of anti-NT5E Pab (Cat. #AP2014a) in Y79 cell line lysate (35ug/lane). .. Ecto-5'-nucleotidase; 5'-NT; CD73 antigen; NT5; NTE
www.abgent.com/products/catalog_no/AP2014a/specification more from same supplier |
ptglab
Genbank accession Number: BC015940 Genbank Define: Homo sapiens 5'-nucleotidase, ecto (CD73), mRNA (cDNA clone IMAGE:3920680), complete cds Alternative Symbols: There may be lots .. If your publishing research used Anti-NT5E, please let us know so that we can cite the reference on this datasheet.
www.ptglab.com/data/image/pdf/E__web_pdf_12231-1-AP.pdf |
ab-direct
basic protein NEW Cell Biology (see page opposite) and clone OX-42, which is an excel ent rat microglia marker (see REAGENTS Reagents page 7). .. Neurology Reagents Myelin Basic Protein Antibodies for Studying Demyelination
www.ab-direct.com/uploads/supplement-2006-12.pdf |
assaydesigns
nents from dif nents fr fer om dif - fer Phosphate buffered saline containing BSA ent kit lots or use reagents beyond r 2. phospho Hsp27 Standard the expiration date 0. .. Materials Needed but Not Supplied 1. Deionized or distilled water. 2.
www.assaydesigns.com/objects/catalog/product/extras/900-170.pdf more from same supplier |
alpco
elism with serum samples: Purposes Serial dilutions of human serum samples gave excel ent paral elism with the standard curve (see figure 1). .. Stability of Serum Leptin: Leptin appears to be stable under common conditions of sample
www.alpco.com/pdfs/22/22-LEP-R42.pdf |
immuquest
DNA-directed RNA polymerase II largest subunit Antibody .. Ent Antibody .. Entactin 1 Antibody
www.immuquest.com/sitemap.asp |
biolegend
Alexa Fluor 647 anti-mouse CD73 .. Biotin anti-mouse CD73
www.biolegend.com/index.php?page=pro_sub_cat&action=search&criteria=IL-11 |
biotrend
80-1519 nents from dif nents fr fer om dif - fer ent kit lots or use Tris buffered saline containing detergents. .. Storage All components of this kit, except the standard, are stable at 4ºC until the kit'
www.biotrend.com/download/900-152.pdf more from same supplier |
abnova
b>NT5E monoclonal antibody (M01), clone 4C4-2B5 .. CD73, E5NT, NT5, NTE, eN, eNT .. CD73, E5NT, NT, NT5, NTE, eN, eNT
www.abnova.com/Products/products_list.asp?classid=AFAAAI000000&OwnClass=3&ClassL1=A&ClassL ... more from same supplier |
caltagmedsystems --- Mouse anti Human NT5E monoclonal antibody (M01) - Caltag Medsystems
Product Details Mouse anti Human NT5E monoclonal antibody (M01) .. Further information: Antigen Synonyms - CD73 - E5NT - NT - NT5 - NTE - eN - eNT
www.caltagmedsystems.co.uk/pricing_ordering/product_detail.php?CI_ID=142444 more from same supplier |
orgentec
Die progressive systemische Sklerodermie (PSS) ist eine multisystemische Erkrankung des ent- zündlich-rheumatischen Formenkreises, die durch eine Verdickung und Verhärtung der .. Proteinen, u.a.
www.orgentec.com/user_images/73/259306958_633-0503-01-d.pdf |
orbigen
biochemlinks.com [Tous Public [Site am ricain en Anglais dyann@schmidel.com .. Very comprehensive list of entomology resources. .. www.ent.iastate.edu/list/ [22k]
www.orbigen.com/commerce/misc/links.jsp |
alomone
3 A 50 ms HpTx 2 - f ractio n of inhibited c urr ent 0.2 0.2 0.1 0.5 0 0 10 20 30 40 50 60 70 80 90 100 0 -50 0 50 Inhibition of KV4. .. Document Outline
www.alomone.com/System/UpLoadFiles/DGallery/Docs/RTH_340.pdf |
genlantis
For your convenience, three differ- for easy cloning Levels in Mammalian Cells phCMV 1 ent phCMV vectors, phCMV1, · Small vector size for efficient I III I H I I II R I phCMV2, .. Delivery Vol 2.1 Vol 2.
www.genlantis.com/corp/GTS_v2_1.pdf |
vincibiochem
a protein secreted by visceral fat that mim- been found to be expressed at much higher ent than that of insulin. In a follow-up study, ics the effects of insulin: A. .. A D I P O K I N E S 7 Globular Full-length Adipokine Visfatin RBP4 Leptin Resistin
www.vincibiochem.it/PDFfiles/Newsletter_Adipokines_NP_final_lowres.pdf more from same supplier |
openbiosystems
Recombinant fragment corresponding to EMSY ENT domain: MPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTER .. Goat polyclonal to EMSY
www.openbiosystems.com/AntibodyData/AntibodyData.aspx?abid=ab4579 |
caymanchem
New ent-Prostaglandin F2α EIA Kit .. (+)-Fluprostenol EIA Kit (Solid Plate)
www.caymanchem.com/app/template/productQualifiers,ProductQualifier.vm/productqualifier/eia ... more from same supplier |
europa-bioproducts --- ent- Galanthamine
UBG1043-25J .. ent- Galanthamine .. UBG1043-25J
www.europa-bioproducts.com/products/218695 more from same supplier |
researchd
LOT# see data sheet with shipm ent .. Package Size: 100 micrograms purified IgG2a in 1ml PBS with 0.09% NaN3.
www.researchd.com/cytokines/gmcsfab.htm |
ebioscience
New Regulatory Reagents: Folate Receptor 4 (FR4), CD39, CD73 .. Ordering Information: Foxp3, Human, Mouse, Non-Human Primate
www.ebioscience.com/ebioscience/whatsnew/TregPage/Treg.htm more from same supplier |
inovadx
biologiques et cliniques est une aide pour le diagnostic de la maladie coeliaque ou entéropathie sensible au gluten. .. Contenu du coffret 1. Une plaque de microtitration en polystyrène (bleu/vert titré en couleurs), 12 (1 x 8) puits de microtitration avec un
www.inovadx.com/Products/di_pdfs/708945/628945revFRA0.pdf more from same supplier |
antibodyshop
E N D O C R I N O L O G Y potent gut hor- mone to stimulate Proglucagon glucose-depend- ent insulin secre- GRPP Glucagon IP-1 GLP-1 IP-2 GLP-2 tion in response to food, both GLP-1 .. As published in CLI September 2007 E N D O C R I N O L O G Y by far the highest brain
www.antibodyshop.com/content/download/1228/36434/version/8/file/The+anorectic+gut+hormones ... |
tepnel
ion analysis in-vit ro has pect ive subst rat e of alkaline phosphat a- alw ay s b e en ham p er ed b y ar t ef ac t s se and peroxidase, give blue/ purple and f or t his year, .. low cyt omet ry ( F) CD5/ CD2 0 By Dr Claudine Vermot -Desroches Diaclone of f ers reag ent s such as monoclo- some compet it ors.
www.tepnel.com/uploads/File/downloads/newsletters4.pdf |
biomax
1.E+05 1.E+04 1.E+04 i t y i t y 1.E+03 t ens I n 1.E+03 c ent c ent Intens es l uores 1.E+02 F l uor F 1.E+02 1.E+01 1.E+01 1.E+00 1.E+01 1.E+02 1. .. Document Outline
www.biomax.us/pdfs/ubi_mousecytokinearrayfluo.pdf |
fermentas
o fi 50%. .. - ng rRNA ore, ent and ds is an e d cDNA tion a rose gel or gene i al to use Theref at y combini.fermentas. .. C. s TM or aq entrifuge ice. t 37° t -20°C See der: n a.fermentas.com y, c reamT 45°C..
www.fermentas.com/profiles/kits/pdf/coa_k1612.pdf |
jenabioscience
for Maximum Convenience Ready-to-Use Mixes for direct gel loading contain an inher- ent red dye and allow the direct loading of the PCR product onto an agarose or acrylamide .. Core Kits Complete sets of reagents required for PCR Standard PCR Jena Bioscience Core
www.jenabioscience.com/images/741d0cd7d0/brochure_molecularbiology.pdf |
innogenetics
2004 jaarbrochure van wetenschap tot product re fe re nt i e d o c u m e nt INNOGENETICS .. Commissie voor Uitsluitend ter informatie is ook een elektronische Bank-, Financie- en Assurantiewezen Innogenetics versie van de Jaarbrochure verkrijgbaar via het NV de
www.innogenetics.com/nederlands/pdf/Jaarbrochure_2004_Referentiedocument.pdf |
medicorp
Description: CD73 (27-252aa) .. Quantity: 0.1 ml
www.medicorp.com/web/suppliers.php?supplier=Acris&sup=Acris&p_cat=0&page=34&lang=en |
genwaybio
factor 5, Neurotrophin 4, Neurotrophin 5, Neurotrophin 5 precursor, NT 4, NT4 / 5, NT4, NT5, .. factor 4 Neurotrophic factor 5 Neurotrophin 4 Neurotrophin 5 Neurotrophin 5 precursor NT 4 NT4 / 5 NT4 NT5 NTF4 NTF5
www.genwaybio.com/all_monoclonal_antibodies.php?fl=N&page=1&sort=3a |