| Webpages from suppliers (information here can not be filtred).
|
origene --- OriGene - NM_004577 cDNA Clone - Homo sapiens phosphoserine phosphatase (PSPH) as 10 ug
Homo sapiens phosphoserine phosphatase (PSPH) as 10 ug transfection-ready DNA NM_004577.3 .. HuSH 29mer shRNA Constructs against PSPH
www.origene.com/cdna/trueclone/accession/NM_004577/SC128000.aspx more from same supplier |
lsbio --- Phosphoserine Phosphatase (PSPH) Mouse anti-Human Monoclonal Antibody see more information about this reagent
Phosphoserine Phosphatase (PSPH) Mouse anti-Human Monoclonal Antibody .. Recombinant human PSP (1-225aa) (E. coli) .. PSPH, EC 3.1.3.3, PSP, PSPASE
www.lsbio.com/Products/Antibodies/AntibodyDetail.aspx?AntibodyID=37745 more from same supplier |
yesbiotech
Prostate Secretory Protein (PSP), monoclonal anti-human .. YPSP-1
www.yesbiotech.com/antibodies_mabmarkers.htm |
anogen
Prostate Secretory Protein (PSP), monoclonal anti-human .. YPSP-1
www.anogen.ca/antibodies_mabmarkers.htm |
komabiotech
Recombinant human Phosphoserine phosphatase (PSP) .. (1-225aa) purified from E. coli
www.komabiotech.com/shop/dvProduct.phtml?pid=049425_K2011085&pcode=6 |
assaydesigns --- PSPase Phosphoserine Polyclonal Anti
Home Products Phosphoserine Polyclonal Antibody .. Phosphoserine Polyclonal Antibody .. KAP-ST210E .. Phosphoserine Polyclonal Antibody, Biotin Conjugate .. KAP-ST2101E .. Phosphoserine Polyclonal Antibody, HRP Conjugate
www.assaydesigns.com/ccp2871-phosphoserine-polyclonal-antibody.htm more from same supplier |
abraxiskits
Importance of the Saxitoxin Determination Saxitoxin (PSP) ELISA, Microtiter Plate Saxitoxin is one of the "paralytic shellfish poisons" ( .. Working Instructions The concentrations of the samples are determined using this
www.abraxiskits.com/moreinfo/PN52255BUSER.pdf more from same supplier |
biosense
product for rapid, real time mussel tissue testing and compliments the Saxitoxin (PSP) and our ASP (Domoic Acid) ELISA kits. .. The Okadaic Acid ELISA is an immunoassay for the quantitative and sensitive
www.biosense.com/nettbutikk/render.asp?dsp=gridSelected&searchgroup=alt10&lgusr=&dsct=0&ge ... more from same supplier |
arp1
Recombinant, E. coli. expression systems. Affinity Purified. Size: 50ug .. Phosphoserine Phosphatase (PSP), human .. Product Description: Phosphoserine Phosphatase (PSP), human. Recombinant, E. coli.
www.arp1.com/product_detail.php?p_id=01-2259 |
tocris
Price and Availability .. Click here for full price details of .. Chemical Name: DL-2-Amino-3-phosphonopropionic acid .. Soluble to 100 mM in 1eq. NaOH .. For specific/earlier batch please select: 9 8 7 6
www.tocris.com/products/AP3_DL.php |
caltagmedsystems
Notes: Antigen Synonyms - ICRF - MGC12447 - P19 - PSP - PSPS - PSPS1 - PTP - REG .. Product Code: H00005967-M04
www.caltagmedsystems.co.uk/pricing_ordering/product_detail.php?CI_ID=142926 more from same supplier |
4adi --- Trefoil factor family TIFF TFF1 tff2 tff3 PSP hSP hITF gastrointestinal estrogens mucins m ...
Home ADI Shop Product ZIP62-A .. ZIP62-A .. ZIP62-A .. Anti-Human Zinc Transporter 6 (ZIP6) IgG #1 (aff pure) 100 ug Antibody Pure IgG .. Data Sheet of Human Zinc Transporter 6 Antibody# ZIP62-A and control peptide #
www.4adi.com/adishop/index.php/action/item/id/3267/prevaction/category/previd/2/prevstart/ ... more from same supplier |
assaypro
Alphabetic List of Antibodies .. Obestin .. PAI-1 Plasminogen Prolactin (PRL) Protein C PPAR-alpha PPAR-gamma PAI1/tPA Progesterone .. Retinol Binding Protein Resistin Recoverin RAC1 RXR-alpha RBP4
www.assaypro.com/antibody_o.asp |
alomone
protein with a sequence RSKKLEHSNDPFNVY IESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETK PSP, corresponding to residues 67-129 of human KCNE1 (IsK) (Accession P15382). .. Intracellular, C-terminus.
www.alomone.com/p_postcards/database/62.htm |
cedarlanelabs
igbf, msp, mspb, pn44, prps, psp, psp-94, psp57, psp94 .. aah05257
www.cedarlanelabs.com/US/abnova.asp?action=details&pid=H00004477-A01-50UL more from same supplier |
biovendor
Human Reg protein family consists of Reg 1 alpha (also cal ed PSP, Lithostatine, PTP, regenerating gene I), Reg 1 beta/ RegL, HIP/PAP and Reg IV. .. 4.
www.biovendor.com/pdf/RD191078100R_Reg_1_alpha_Human_ELISA.pdf |
ibl
Human Reg protein family consists of Reg 1 alpha (also cal ed PSP, Lithostatine, PTP, regenerating gene I), Reg 1 beta/ RegL, HIP/PAP and Reg IV. .. 4.
www.ibl-america.com/pdf/BioVender/RD191078100R_IBL.pdf |
rndsystems
Factor (GDNF) family include GDNF, Neurturin (NTN), Artemin (ART), and Persephin (PSP). .. Neural Cell Adhesion Molecule (NCAM) is widely expressed in the nervous system and plays
www.rndsystems.com/cb_detail_objectname_FA03_NCAM.aspx |
ptglab
CHGA .. CGA; PSP; CMGA; SP-I; CHROMOSTATIN; PANCREASTATIN; Secretory protein I parathyroid secretory .. CKLF
www.ptglab.com/antibody.asp?cat=3&keystr=C more from same supplier |
feldan
98% by SDS-Page analysis. Endotoxin level is less than 0.1ng per ug (1EU/ug) of human PSP. .. The lyophilized PSP is soluble in water and most aqueous buffers.
www.feldan-bio.com/catalog/index.php?act=viewProd&productId=1481 more from same supplier |
peprotech
Recombinant Human Persephin (PSP) .. Recombinant Human Pleiotrophin
www.peprotech.com/category.asp?category_name=Human,+Murine+&+Rat+Neurotrophins(PeproTech+B ... |
immunodetect
Sony Vaio .. Sony PSP .. Sony Laptop
www.immunodetect.com/buy/sony/play/station/sony.com.htm |
ibtsystems
Phosphoserine Phosphatase, human, recombinant .. rHuPSP .. Size: 20 µg/190.- Euro 1 mg/2060.- Euro
www.ibtsystems.de/products/product-overview.html?tx_ttproducts_pi1[begin_at]=1200&tx_ttpro ... |
ibl
Environmental-/food analysis Environmental-/food analysis Saxitoxin (PSP) ELISA .. Saxitoxin (PSP) ELISA .. 50 µL water samples or shellfish sample extracts
www.ibl-hamburg.com/products.0,l.0.cat.Environmental-%2Ffood+analysis.pg.Environmental-%2F ... |
gentaur
Prostate Secretory Protein (PSP) .. BDI248 Unit:
www.gentaur.com/instant_blue_files/nieuwe_pagina_60.htm more from same supplier |
antibodyresearch
Your partner in antibody development and manufacturing .. Quantity .. ACAD8, Acyl-Coenzyme A Dehydrogenase 8 .. ACAT2, Acetyl-Coenzyme A acetyltransferase 2 .. Adenosine Deaminase tRNA-Specific 1
www.antibodyresearch.com/files/proteins_enzymes.html |
biochain
Parkinson's Disease, Dementia, Multiple Sclerosis, Progressive Supranuclear Palsy (PSP), and Depression diseases. .. Note: For custom designed products, please fill the form for a quotation.
www.biochain.com/biochain/shop3.aspx?sub_category=Frozen Tissue Section Panel&species_name ... |
komabiotech
DL-2-Amino-3- .. phosphonopropionic acid .. Soluble to 100 mM in 1eq. of NaOH .. Competitive group I metabotropic glutamate receptor antagonist and inhibitor of .. Evans et al (1982) The effect of a series of w-phosphonic-a-carboxylic amino acids on
www.komabiotech.co.kr/product/neuro/category/protphos.htm |
genwaybio --- PSPH protein, Phosphoserine Phosphatase (PSP) Human recombinant protein
Mutations responsible for 3-phosphoserine phosphatase deficiency. .. Phosphoserine Phosphatase (PSP) Human recombinant protein .. Buy PSPH protein - .. - EC 3.1.3.3; PSP; O-phosphoserine phosphohydrolase; PSPase; L-3-phosphoserine phosphatase; Phosphoserine phosphatase
www.genwaybio.com/product_info.php?products_id=45546 more from same supplier |