| Webpages from suppliers (information here can not be filtred).
|
cellsignal
Product Pathways - Nuclear Receptor Signaling SRC-3 (11B1) Mouse mAb #2115 .. IgG1 and Kappa light chain .. Applications Key: W=Western Blotting IF-IC=Immunofluorescence (Immunocytochemistry) F= .. SRC-3 (11B1) Mouse mAb detects endogenous levels of total SRC-3 protein.
www.cellsignal.com/products/2115.html more from same supplier |
novusbio
E2F 1 Related Products .. Catalog Number: NB600-208 .. [ home search NB600-208 ] .. E2F 1 antibody .. Mouse Monoclonal anti-E2F 1 (2B5) .. Clone 2B5 recognizes E2F-1 that was identified as a cellular protein with DNA binding
www.novusbio.com/data_sheet/index/NB600-208&prev_module=search more from same supplier |
usbio see more information about this reagent
Human Ubquitin Conjugating Enzyme 7 (UbcH7) is a class I enzyme which functions in the stress response and the control of .. MHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK
www.usbio.net/displayPage.php?ProdSku=U0880-02A more from same supplier |
axxora --- Polyclonal Antibody to UbcH7 - BST-A-640
b>UbcH7 mediates the selective degradation of short-lived and abnormal proteins and is highly .. Polyclonal Antibody to UbcH7
www.axxora.com/ubiquitin__proteasome-BST-A-640/opfa.1.1.BST-A-640.1648.4.1.html more from same supplier |
cedarlanelabs
a. ~ 155 a.a) full length recombinant protein with GST tag. .. UBE2L3 monoclonal antibody (M01), clone 3B7 .. E2-F1, L-UBC, UBCH7, UbcM4
www.cedarlanelabs.com/US/abnova.asp?action=details&pid=H00007332-M01-100UG more from same supplier |
caltagmedsystems
Product Code: H00007332-P01 .. Product Details UBE2L3 Recombinant Protein (P01) .. Notes: UBE2L3 - ubiquitin-conjugating enzyme E2L 3 - Alias - E2-F1 - L-UBC - UBCH7 - UbcM4
www.caltagmedsystems.co.uk/pricing_ordering/product_detail.php?CI_ID=156837 more from same supplier |
prosci --- UBE2L3 Antibody :: Primary Antibodies :: ProSci Incorporated
Description Left: Western blot analysis of UBE2L3 in Hela lysate (RIPA buffer, 35 g total protein per lane) using UBE2L3 antibody ( .. Additional Names UBE2L3; ubiquitin-conjugating enzyme E2L 3; UBCH7
www.prosci-inc.com/shop/catalog1/UBE2L3-Antibody-p-26164.html more from same supplier |
avivasysbio --- ARP43026_P050-NP_003338-UBE2L3(ubiquitin-conjugating enzyme E2L 3) Antibody-Aviva S ...
b>ube2l3 .. e2-f1, l-ubc, ubch7, ubcm4
www.avivasysbio.com/commerce/ccp8678-ube2l328ubiquitin-conjugating-enzyme-e2l-329-antibo-n ... more from same supplier |
acris
Show all E2F1 .. Antibody : E2F1 .. IF, EMSA .. Background: E2F's are DNA-binding proteins that associate with negative regulators, such .. Clone: KH20 .. Immunogen: Recombinant Human E2F-1 protein.
www.acris-antibodies.com/products/acris/AM00305PU-N/antibody/E2F1.html more from same supplier |
biomatrix
Mouse monoclonal antibody Anti-Human E2F1 .. Catalog No. BMR00440 .. The protein encoded by this gene is a member of the E2F family of transcription factors. .. Western blot analysis of immunized recombinant protein, using anti-E2F1
www.biomatrix.co.jp/product/mono/catalog/BMR00440.html more from same supplier |
genetex --- GTX90891-UBE2L3 [3B7] antibody -GeneTex Inc
GTX22249 .. Mouse monoclonal [3B7] to UBE2L3 .. Abnova H00007332-M01
www.genetex.com/commerce/ccp33487-ube2l3-5b3b75d-antibody-h00007332-m01-gtx90891.htm more from same supplier |
4adi
Sheep (non-immune) control Serum IgA purified .. Hamster IgG control #20003-1 .. DiPaola R 2004 Clinical Immunol. .. Jin VX 2006 Genome Res., Dec 2006; 16: 1585 - 1595. .. chromatin microarray .. Bieda M 2006 Genome Res.
www.4adi.com/commerce/ccpc2491-9472-sheep-28non-immune29-control-serum-iga-purified-pure-i ... more from same supplier |
orbigen
Rsp5p .. BVC-10104 .. The full length S. .. Rsp5p .. Huibregtse JM, Scheffner M, Beaudenon S, Howley PM: A Family of Proteins Structurally .. Wang G, Yang J, Huibregtse JM: Functional domains of the Rsp5 ubiquitin-protein ligase.
www.orbigen.com/commerce/catalog/product.jsp?product_id=1095 more from same supplier |
jenabioscience
Data sheet p300-Ch1 (residues 302-531) (Tumor Suppressor Protein) Human, Recombinant, E.
www.jenabioscience.com/images/f33e6f1230/PR-844.pdf |
feldan
Recombinant Human Ubiquitin Conjugating enzyme E2 L3 (ubch7) .. Price: $50.00 Product Code: FB03-30-889
www.feldan-bio.com/catalog/index.php?act=viewProd&productId=1288 more from same supplier |
ptglab
cerevisiae,homolog of; Ubiquitin-conjugating enzyme E2 G2; Ubiquitin-protein ligase G2;Ubiquitin carrier protein G2; .. Purified Rabbit Anti Human UBE2G2 Polyclonal antibody
www.ptglab.com/datasheet.asp?catNo=10722-1-AP&Promotion=free more from same supplier |
gentaur
b>UbcH7 .. UbcH7, Dominant Negative
www.gentaur.com/enzymes.htm more from same supplier |
vincibiochem
b>UbcH7 .. UbcH7, Dominant Negative
www.vincibiochem.it/NovitaBoston.htm |
panomics
Products Protein Analysis TF ELISA Kits .. Quantify activation of AP-1, ER alpha, GATA1, GR, HIF-1 alpha, MEF-2, NFkBp50, NFkBp65, .. Detect activation with as little as 0.5 g of nuclear extract
www.panomics.com/product.php?product_id=23 more from same supplier |
atlasantibodies
Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19) (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T). [Source:Uniprot/SWISSPROT;Acc:Q9NPD8] .. Immunoperoxidase staining of formalin-fixed, paraffin-embedded human rectum tissue
www.atlasantibodies.com/store/view/2831?filter=U&page=1&scaffold_id=product&sort=product_n ... |
australbiologicals
Email: sal aus r i l i a com .. Interleukin-2 human (IL-2) (RECOMBINANT) .. Interleukin-6 human (IL-6) (RECOMBINANT) .. Epidermal Growth Factor (EGF) human (RECOMBINANT) .. Epidermal Growth Factor (EGF) human (RECOMBINANT)
www.australbiologicals.com/index.php?what=catalog&all=true&printer_friendly=true&print=tru ... more from same supplier |
abgent
b>UbcH7-BP Antibody (C-term) .. UBE2L3 Antibody (C-term)
www.abgent.com/protein_modification/ubiquitination more from same supplier |
natutec
b>ubch7 .. cul4a
www.natutec.de/english/search.php?level1=1&level2=54&level3=&query=&start=1100&slimit=50 more from same supplier |
shanghaigenomics
b>ubch7 .. ubc9
www.shanghaigenomics.com/english/chanpin1-2.htm |
lucerna
apex1 maxpab .. arl2 maxpab .. atp1b3 maxpab .. bag1 maxpab .. bdkrb1 maxpab .. birc5 maxpab .. c2 maxpab .. c5r1 maxpab .. cd14 maxpab .. cdc25c maxpab .. cdk6 maxpab .. cfhl1 maxpab .. ckmt1b maxpab
www.lucerna-chem.ch/index.php?id=126&type=98 |
biolegend
p53-Associated Parkin Like Cytoplasmic Protein, UbcH7 associated protein 1, H7AP1, H7/AP1, KIAA0708 .. Contains a cullin domain and signature motif RING-IBR (in between ring finger domain)-
www.biolegend.com/products/index.cfm?cfid=2648379&cftoken=79014507&fuseaction=products.pro ... more from same supplier |
meso
Proteins Signal 5,000 0 0 1 2 3 4 5 6 7 8 9 10 Ub E2 (pmol) 35,000 UbcH7 30,000 (UBE2L3) E2 25,000 20,000 Signal 15,000 10,000 His 5,000 6-Tag 0 0 10 20 30 40 50 60 E2 (pmol) .. ® Assays for Studying Ubiquitylation and E3-Substrate Interactions in Cells SULFO-TAG- K.
www.meso-scale.com/CatalogSystemWeb/WebRoot/literature/applications/pdf/Ubiquitin_HTS.pdf |
mesoscale
Proteins Signal 5,000 0 0 1 2 3 4 5 6 7 8 9 10 Ub E2 (pmol) 35,000 UbcH7 30,000 (UBE2L3) E2 25,000 20,000 Signal 15,000 10,000 His 5,000 6-Tag 0 0 10 20 30 40 50 60 E2 (pmol) .. ® Assays for Studying Ubiquitylation and E3-Substrate Interactions in Cells SULFO-TAG- K.
www.mesoscale.com/CatalogSystemWeb/WebRoot/literature/applications/pdf/Ubiquitin_HTS.pdf |
hypromatrix
www.hypromatrix.com anti-Rb p110 PRODUCTS FROM HYPROMATRIX, INC. Cat #: HM1315 A.
www.hypromatrix.com/Products/Primary_Antibody/Rb (p110).pdf |
genwaybio
E2F1 Antibody, Rabbit IgG Polyclonal Antibody .. Buy E2F1 antibody - .. Gene Name: E2F1 .. Gene Name Synonym: RBBP3 .. Swiss Prot Acc #: Q01094 .. Mol. Weight (Da): 46920 .. APPLICATIONS for E2F1 ANTIBODY:
www.genwaybio.com/product_info.php?products_id=195543 more from same supplier |