| Webpages from suppliers |
rndsystems
Recombinant Mouse SR-AI/MSR1, CF .. ALL SR-AI/MSR .. SR-AI/MSR
www.rndsystems.com/product_results.aspx?m=2118&c=0 more from same supplier |
origene --- Homo sapiens progestin and adipoQ receptor family member VII (PAQR7) as 10 ug transfection ...
Homo sapiens progestin and adipoQ receptor family member VII (PAQR7) as 10 ug transfection-ready DNA NM_178422.4 .. HuSH 29mer shRNA Constructs against PAQR7
www.origene.com/cdna/trueclone/accession/NM_178422/SC307170.aspx |
ab-direct
b>MSR TYPE I .. Pack Size: 20 µl
www.ab-direct.com/catalog/productlist.aspx?SearchType=TableCatalogue&SearchString=table:10 ... more from same supplier |
novusbio
11 antibody; Anti-HG11 antibody; Anti-MGC45246 antibody; Anti-MSR antibody; Anti-msr/apj antibody .. GPCR (G Protein-Coupled Receptor), IHC Grade
www.novusbio.com/data_sheet/index/NLS63&prev_module=search more from same supplier |
lsbio
The following page provides information on all PAQR7 -related products. .. Membrane Progestin Receptor Alpha (PAQR7) .. GPCR, Membrane progestin receptor, PAQR7, 2310021M12RIK, MPRA, MRPA, MSR, membrane progestin receptor alpha, mPRA, mPRalpha
www.lsbio.com/Products/GeneDetail.aspx?LSID=163982 more from same supplier |
usbio
Macrophage Scavenger Receptor Type 1, CT (MSR.. .. Melanin Concentrating Hormone Receptor 2, Hum..
www.usbio.net/displayPage.php?Category=Molecular Biology&subCategory=MB-Receptors&pageNum= ... |
cosmobio --- Anti Human Macrophage Scavenger Receptor A (MSR- A:CD204) Monoclonal Antibody (Clon ...
useful antibody for the study of MSR-A in atherogenesis and various other pathological conditions. .. Anti Human Macrophage Scavenger Receptor A (MSR- A:CD204) Monoclonal Antibody (
www.cosmobio.co.jp/export_e/products/antibodies/products_KAL_20071115.asp more from same supplier |
biologo
b>MSR-A, CD204, ein 72 kDa Glykoprotein aus histiozytären Makrophagen .. Der Makrophagen-Scavenger-Rezeptor (MSR-A) wurde identifiziert bei der Suche nach einem
www.biologo.de/standard/1036/Forschung/CD204-1.html |
acris-antibodies
Alternate names: MSR Type I .. Background: MSR1 has been shown to be expressed on microglia and mato cells of the brain
www.acris-antibodies.com/products/acris/SP1282/antibody/CD204__(Macrophage_Scavenger_Recep ... more from same supplier |
researchd
Macrophage scavenger receptors (MSR) are membrane glycoproteins that mediate the recognition and uptake of a wide variety .. The observation that the,4 allele of the apolipoprotein E gene is associated with an
www.researchd.com/neuroabs/msrt.htm |
eurogentec
Charts Protocols The SoluLinK Bioconjugation Process 13 Molar Substitution Ratio (MSR) Description 15, 83, 90 Superior Stability Explained 15 Example Protein Protein .. The Conjugation CompanyTM Products, Kits Services About SoluLinK SoluLinK specializes in
www.eurogentec.com/EGT/files/SoluLinK Catalog No Prices.pdf |
cedarlanelabs
MGC129643, MSR .. MTRR (NP_002445, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
www.cedarlanelabs.com/US/abnova.asp?action=details&pid=H00004552-A01-50UL |
4adi
Sequence alignment of Cox-1, Cox-2, and Cox-3 .. 10 20 30 40 50 60 COX1 MSR-SLLLR-FLLFLPPLPVLLADP COX3 MSREFDPEAPRNPLRLPGEPRMPGPALTSRSAGGSRLHRWPLPVLPAEA COX2 - .. Return to COX Antibody page
www.4adi.com/seqs/cox13seqs.html |
inovadx
ANA ELSA avec un coffret NOVA LiteTM HEp-2 : INOVA ANA ELISA Negatifs Positifs MSR n=100 Negatifs 1 3 IFI sur cellules HEp-2 Positifs 9 87 3 échantillons concernent des .. une fois par jour, pendant 6 jours. Results are tabulated below.
www.inovadx.com/Products/di_pdfs/708750/628750rFrench.pdf |
genetex
Recognizes the 75kD membrane glycoprotein human macrophage scavenger receptor (MSR) type 1. .. Synthetic peptide corresponding to aa 325-342 of human MSR1
www.genetex.com/commerce/ccp20440-macro-scav-rec1-sample-antibody-ahp563t-gtx74367.htm |
immunovision
Custom IgM fractions can be purified upon request. .. Mouse MSR-1000 100ml/300.00 MSR-2000 1g/370.00 MSR-3000 50mg/300.00 MSR-1001 500ml/900.
www.immunovision.com/products/product-04-02-2003_13-28-11.pdf more from same supplier |
openbiosystems
Progestin and adipoQ receptor family member V .. PAQR7 .. Progestin and adipoQ receptor family member VII
www.openbiosystems.com/GeneSets/Human/GPCR/index.html |
bachem
Sie besitzen gute Kenntnisse im Bereich der MSR-Technik und erstellen Zeichnungen und Schemata mittels CAD. .. Wünschenswert sind
www.bachem.com/index.cfm?uuid=FF3003D79ADF417C995126F0ADDC9633&action=detail&ID=238&countr ... |
invitrogen
Nontransfected GripTite™ 293 MSR cells were stained with 2 µM FlAsH-EDT2 labeling reagent according to the protocol .. Table 1—TC-FlAsH™ TC-ReAsH™ products
www.invitrogen.com/content.cfm?pageid=11625 |
genwaybio
pure 14 amino acid sequence from the C terminal of Glutamate receptor 7 (beyond the MSR IV region). conjugated to KLH. .. GRIK3 ANTIBODY TARGET DESCRIPTION:
www.genwaybio.com/product_info.php?products_id=77678 more from same supplier |