| Webpages from suppliers (information here can not be filtred).
|
origene --- OriGene - NM_198465 cDNA Clone - Homo sapiens Nik related kinase (NRK) as 10 ug transfecti ...
Homo sapiens Nik related kinase (NRK) as 10 ug transfection-ready DNA NM_198465.1 .. HuSH 29mer shRNA Constructs against LOC203447 .. shRNA Constructs against Mus musculus Nrk
www.origene.com/cdna/trueclone/accession/NM_198465/SC307708.aspx |
usbio see more information about this reagent
You are here: Home Antibodies Abs to Protein Kinase Substrates Cortactin, .. Cortactin is an 80-85kD actin-binding protein, which consists of a variety of protein domains. .. Western Blot: 1-2ug/ml; Detects an 80kD protein from 30ug of EGF/A431 cells and from 50ug NRK-cSRC.
www.usbio.net/displayPage.php?ProdSku=C7901-85 more from same supplier |
lsbio
The following page provides information on all NRK -related products. .. NIK-Related Kinase (NRK) .. Protein Kinase, MSN, NRK, DKFZP686A17109, FLJ16788, MGC131849, NESK, Nck-interacting kinase-like embryo specific kinase, nesk,
www.lsbio.com/Products/GeneDetail.aspx?LSID=53078 more from same supplier |
caltagmedsystems
Product Code: H00004915-M02 .. Home Products > Products for Cell Biology > Kinase .. There are 729 products in this selection. .. Mouse anti Human MUSK monoclonal antibody (M08) - mono ascites (100 µg)
www.caltagmedsystems.co.uk/pricing_ordering/products_ordering.php?CS_ID=132&CG_ID=11&numre ... more from same supplier |
cedarlanelabs
SRVYFMTLGKLEELQSNYDV .. NRK Recombinant Protein (Q01) .. Nik related kinase .. DKFZp686A17109, FLJ16788, NESK
www.cedarlanelabs.com/US/abnova.asp?action=details&pid=H00203447-Q01-2UG more from same supplier |
natutec
Clone: eBioL31 Isotype: Rat IgG2a Staining of mouse CD207-transfected NRK cells with 0.03 µg of PE Rat IgG2a Iso Cntrl (cat. 12-4321) (open histogram) or 0. .. Applications Tested This eBioL31 antibody has been tested by flow cytometric analysis of mouse
www.natutec.de/pdf_ebioscience/12-2075.pdf |
rndsystems
Home Technical Information Literature Cytokine Bulletin The Early History of TGF-beta .. The Early History of TGF-beta .. Figure 1. Original description of autocrine secretion. .. Figure 2.
www.rndsystems.com/cb_detail_objectname_SP05_TGFBHistory.aspx |
ebioscience --- 12-2075 Phycoerythrin (PE) anti-mouse CD207 (Langerin)
Contents: Phycoerythrin (PE) anti-mouse CD207 (Langerin) .. Staining of mouse CD207-transfected NRK cells with 0.03 g of PE Rat IgG2a Iso Cntrl (cat. 12-4321) (open histogram) or 0. .. Phycoerythrin (PE) anti-mouse CD207 (Langerin)
www.ebioscience.com/ebioscience/specs/antibody_12/12-2075p.htm more from same supplier |
assaydesigns --- GRO/CINC-1 (CT) Polyclonal Antibody Antibodies Assay Designs
does not cross react with rat GRO/CINC-2alpha, rat GRO/CINC-2beta and rat GRO/CINC-3 .. Home Products Inflammation GRO/CINC-1 (CT) Polyclonal Antibody .. purified from media conditioned by IL-1b stimulated rat kidney epithelioid cells (NRK-52E), Watanabe¿s group at Toyama Medical and Pharmaceutical University identified the
www.assaydesigns.com/commerce/ccpa1003-6913-6913-gro-cinc-1-28ct29-polyclonal-antibody.htm more from same supplier |
openbiosystems --- Antibody Data for ab14234 (CALR)
Datasheet for Abcam Antibody ab14234 .. Chicken polyclonal to Calreticulin - ER Marker .. Synthetic peptide: AEKQMKDKQDEEQRLKEDKKRKEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL, corresponding to
www.openbiosystems.com/AntibodyData/AntibodyData.aspx?abid=ab14234 more from same supplier |
biolegend
You are here: Mouse Immunology Mouse Innate Immunity MD-1 Biotin anti-mouse MD-1 .. Mouse RP105/MD-1 transfected NRK cells .. Acts in conjunction with the toll-like receptor family members, 28 kD
www.biolegend.com/products/index.cfm?cfid=2648379&cftoken=79014507&fuseaction=products.pro ... more from same supplier |
axxora
Proteins > Natural Proteins .. Vitronectin/Related Products .. Revised 14-Sep-06 .. Multifunctional adhesion glycoprotein with binding sites for e.g. .. Complete amino acid sequence of human vitronectin deduced from cDNA.
www.axxora.com/vitronectin-related_products-ALX-200-082/opfa.1.1.ALX-200-082.1319.4.1.html |
acris
acris-antibodies.com 2 / 2 .. Acris Antibodies GmbH Im Himmelreich 11 D-32120 Hiddenhausen Phone: +49-5221-34606-0 Fax: +49-5221-34606-11 .. # SM5094) and beta-COP (green, Cat. # SP5139P) in NRK cells. For research and in vitro use only. Not for diagnostic or therapeutic work.
www.acris-antibodies.com/sheets/SM5094.pdf more from same supplier |
neuromics
Neuromics Products Antibodies by Category Autism/Asperger's.. .. Type: Mouse IgM .. Structural Maintenance of Chromosome 1 (SMC1) is an ATPase which, with SMC3, forms a heterodimeric
www.neuromics.com/ittrium/visit?path=A1x66x1y1x9fx1y1x246x1y1x487dx1x82y1x487ex1x7f more from same supplier |
biologo
5 Shin,B.K., et al. Global profiling of the cell surface pro.. .. Art.Nr.: Y-21444 Price: 480 € / 0.1 mg .. Cation-dependent mannose-6-phosphate receptor .. FUNCTION: Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to
www.biologo.de/englisch/standard/1650/Forschung/Y-21444.html more from same supplier |
mirusbio --- Citations - Technical Resources Mirus Bio Corporation
McMahon, Yue, Santen, Lawrence 2005. .. Li, Hawkins, Harvey, Jennings, Link, Patton 2003. Regulation of Alternative Splicing by SRrp86 and Its Interacting Proteins Mol. .. Choi, McMahon, Lawrence 2003.
www.mirusbio.com/products/techresources/citation-product.asp?Product=TransIT-LT2 |
epitomics --- Epitomics PKC mu / PKD Phospho (pS916) rabbit antibody - 2085-1
IHC: 1:100 250 .. Name: PKC mu / PKD Phospho (pS916) Rabbit Antibody .. A. Western blot analysis on HeLa cell lysates using anti-Phospho-PKC mu/PKD (p916) RabMAb (cat. .. B. Immunohistochemical analysis of paraffin-embedded human placenta using anti-Phospho-PKC mu/PKD (p916) RabMAb
www.epitomics.com/products/2085-1.php |
avivasysbio --- P101699_T100-NP_445915-Rat Calnuc/RGD:620030 Antibody-Aviva Systems Biology
Also useful as a Golgi marker in immunohistochemistry (1:100 dilution). .. Rat Calnuc/RGD:620030 Antibody .. Polyclonal antibody produced in rabbits immunized with a synthetic KLH-conjugated peptide (Peptide number: P03184)
www.avivasysbio.com/commerce/ccp7519-rat-calnuc-rgd3a620030-antibody-np_445915-p101699_t10 ... |
researchd --- CD115 (CSF Receptor/c-fms) antibodies from RDI Division of Fitzgerald Industries In ...
clone 12-3A3-1B10 cat#RDI-CD115abm-1B $438.00/100ug .. rev: February 8, 2005 .. NOTE: Please inquire for bulk or custom formulations (without preservative or carrier). .. anti-human CD115 antibodies
www.researchd.com/rdicdabs/cd115.htm |
immuquest --- Mouse Anti-Human TGF beta
MERPEN .. Mouse Anti-Human TGF beta .. Alternative Description: CED .. Catalogue Number: IQ159 .. Description: Mouse Anti-Human Transforming Growth Factor, beta 1
www.immuquest.com/AntibodyDetails.asp?AntibodyID=1320 more from same supplier |
btiinc --- Biomedical Technologies, Inc
Copyright BTI Inc. All rights reserved. .. Growth Factor .. Mouse EGF .. mouse submax .. Human EGF .. r-DNA E. coli .. Rat EGF .. rat submax .. ECGS, Endothelial Mitogen
www.btiinc.com/page/cata1.html |
ibl --- Microsoft Word - 17170_Rat_GROCINC-2a_Assay_Kit_-_IBL.doc
in series from media conditioned by IL-1 stimulated rat kidney epithelioid cells (NRK-52E). .. Instructions Code.No. 17170 For Non-Clinical Research Use Only p.2 4.
www.ibl-america.com/pdf/Japanprotocls/17170_RatGC-2a.pdf more from same supplier |
alpco --- Microsoft Word - 48-CINCR-081 CINC-1 _Rat_ EIA [5-31-06].doc
DO NOT use this copy to run your assay; use the protocol included with the kit ONLY. .. CINC-1 (Rat) EIA For the quantitative determination of CINC-1 in rat plasma and serum. .. CINC-1 (cytokine-induced neutrophil chemoattractant) is refined from supernatant of NRK-52E cultivation, which is a normal rat kidney cell type.
www.alpco.com/pdfs/48/48-CINRT-E01.pdf |
atcc
Lu CRL-6569 cusimanse NZP-12 CRL-1921 deer, Columbian black tail OHH1. .. Cell Line Indexes Tissue Source Species Cell Line Name ATCC® No. .. Cell Line Indexes Tissue Source Species Cell Line Name ATCC® No.
www.atcc.org/common/documents/pdf/CellCatalog/CellTissue.pdf |
proqinase --- ProQinase Tools Tests: Science
Protein Kinases .. Useful Links .. acc.to Manning et al. .. ProQinase Name .. Synonyms .. GenBank Acc.No. .. TNK2 .. p21cdc42Hs; Activated CDC42 kinase 1 .. ACTR2 .. ARP-2, actin like protein 2
www.proqinase.com/pages/science/p3_1.html |
genwaybio --- HDAC7A antibody, HDAC7 Antibody, Rabbit IgG Polyclonal Antibody
HDAC7 Antibody, Rabbit IgG Polyclonal Antibody .. Buy HDAC7A antibody - .. Gene Name: HDAC7A .. Gene Name Synonym: HDAC7 .. Swiss Prot Acc #: Q8WUI4
www.genwaybio.com/product_info.php?products_id=195647 more from same supplier |