| Webpages from suppliers (information here can not be filtred).
|
origene --- OriGene - NM_005792 cDNA Clone - Homo sapiens M-phase phosphoprotein 6 (MPHOSPH6) as 10 ug ...
Homo sapiens M-phase phosphoprotein 6 (MPHOSPH6) as 10 ug transfection-ready DNA NM_005792.1 .. HuSH 29mer shRNA Constructs against MPHOSPH6 .. shRNA Constructs against Mus musculus Mphosph6
www.origene.com/cdna/trueclone/accession/NM_005792/SC116530.aspx more from same supplier |
cedarlanelabs
a. ~ 161 a.a) full length recombinant protein with GST tag. .. MPHOSPH6 monoclonal antibody (M01), clone 1D8-2A8 .. M-phase phosphoprotein 6 .. MPP, MPP-6, MPP6 .. MPHOSPH6 (AAH05242, 1 a.a. ~ 161 a.a) full length recombinant protein with GST tag.
www.cedarlanelabs.com/US/abnova.asp?action=details&pid=H00010200-M01-100UG more from same supplier |
caltagmedsystems
Product Details Mouse anti Human MPHOSPH6 monoclonal antibody (M01) .. Notes: Antigen Synonyms - MPP - MPP-6 - MPP6 .. Product Code: H00010200-M01
www.caltagmedsystems.co.uk/pricing_ordering/product_detail.php?CI_ID=144356 more from same supplier |
biomatrix
BMR Monoclonal Antibodies (Human Transcription factors) as of Mar 28, 2008 .. Antibody Applications Reactivity Catalog No. Antibody Synonyms Clone Isotype Accession No.
www.biomatrix.co.jp/eng/product/mono_search/data/Monoclonal-list.pdf |
gentaur
b>Antibody Sampler Kit .. Immunological .. Immunological Products A .. Immunological Products B .. Immunological Products C .. datasheet gw/Caspase 14 polyclonal antibodies.doc
www.gentaur.com/instant_blue_files/gencompare.htm |
rndsystems
Home Technical Information Literature Cytokine Bulletin TIQ and Parkinsons Disease .. TIQ and Parkinsons Disease .. Figure 1. Chemical structures of MPTP, its metabolite MPP+, and various MPTP analogues.
www.rndsystems.com/cb_detail_objectname_FA01_TIQ.aspx |
openbiosystems --- Open Biosystems - Human Cell Cycle
Zinc finger, ZZ-type with EF-hand domain 1 .. Human Cell Cycle Full-Length cDNA .. Human Cell Cycle Full-Length cDNA (pCMV) .. Human Cell Cycle Entry ORFs .. NEW! Mouse Cell Cycle GIPZ lentiviral shRNAmir
www.openbiosystems.com/GeneSets/Human/CellCycle/index.html |
4adi --- Monocarboxylate Transporters (MCT 1-8)sequence alignment
mMCT8 MALPSPASEEAEGPCQEANQEYQEPVCSPVPEPDPEPVPVPPPEPQPEPE 70 80 90 100 110 120 rMCT1 -MPP-AIGGPVGY-TP rMCT2 -MPSESSVKATAAPPPFPLP rMCT3 -MGG--AVVDEGP-TGIKA mMCT4 -MG-AGGPRRGAGP .. Alignment data :
www.4adi.com/seqs/mct18seq.html more from same supplier |
biologo
2 Strausberg,R. Direct Submission.. .. Art.Nr.: Y-22405F Price: 480 € / 0.1 mg .. M-phase phosphoprotein 6 .. PTM: Phosphorylated in M (mitotic) phase. .. SIMILARITY: Belongs to the MPP6 family.
www.biologo.de/englisch/standard/2262/Forschung/Y-22405F.html more from same supplier |
orbigen
b>Antibodies : Kinases .. ERBB-4 Receptor Protein Tyrosine Kinase (ERBB4) polyclonal antibody .. Maintain refrigerated at 2-8oC for up to 6 months. For long term storage store ar -20oC.
www.orbigen.com/commerce/catalog/product.jsp?product_id=2734 |
ebioscience --- PE anti-mouse CD244.2 (2B4 B6 Alloantigen) antibody: r-phycoerythin (r-PE) conjugat ...
J Immunol. 1993 Nov 15;151(10):5328-37. .. Phycoerythrin (PE) anti-mouse CD244.2 (2B4 B6 Alloantigen) .. Contents: Phycoerythrin (PE) anti-mouse CD244.2 (2B4 B6 Alloantigen) .. Clone: eBio244F4 .. Isotype: Rat IgG2a
www.ebioscience.com/ebioscience/specs/antibody_12/12-2441.htm more from same supplier |
komabiotech --- Steroid Hormones
Androgen Receptor Compounds .. → Estrogen Receptor Compounds .. → Glucocorticoid Receptor Compounds .. → Mineralocorticoid Receptor Compounds .. → Progesterone Receptor Compounds
www.komabiotech.co.kr/product/neuro/category/steroidhorm.htm |
tebu --- News: MaxPab silencing efficiency assessment
SAP30BP / SCAMP2 / SERPINI2 / SFXN2 / SNIP1 / SOD2 / TPD52 / TPD52L1 / TRAM1 / WDR45 .. Special Offer .. MaxPab special offer .. 25 Jan .. MaxPab silencing efficiency assessment
www.tebu-bio.com/file/news/96/index.html?printpage=1 more from same supplier |
ssi --- Statens Serum Institut - About SSI - Organisation - Departments - Bacterial Vaccine Depart ...
Organisation .. - Organisation Chart .. - The Institute Council .. - Management Board .. - Mission Statement .. - Key Figures .. Contact SSI .. Annual Report
www.ssi.dk/sw1137.asp more from same supplier |
perkinelmer --- Radiolabeled Ligands from PerkinElmer
Fluorescence Polarization .. Radiometric .. Filter Binding & Filtration Assays .. FlashPlate .. Image FlashPlate .. Time Resolved Fluorescence .. -Bungarotoxin, [125I]Tyr54-, 250 Ci (9.25MBq), Specific Activity:10-20 Ci (370-740kBq)/ g
las.perkinelmer.com/drugdiscovery/Catalog/category?CategoryID=Radiolabled+Ligands&pn0=HTS+ ... more from same supplier |
mitosciences --- MitoSciences: MitoNews Volume 01, Issue 3
Copyright 2004-2005 MitoScience LLC .. MitoNews Archive .. Volume 01, Issue 03 - March, 2005 .. MitoNews .. Mitochondrial Research Bulletin .. Published by: .. Advancing Vital Discoveries in Mitochondrial Research
www.mitosciences.com/mitonews_01_03.html |
tocris --- Browse Products Alphabetically, by Date Added or by Pharmacological Action Tocris Bioscien ...
Distributors Glossary Ordering Security Privacy Terms Conditions Services Site Map .. Welcome to Tocris .. View Basket Checkout Log In .. Quick Search Biological Activity CAS Number Molecular Formula
www.tocris.com/browse.php?View=Summary&Type=Alpha&Value=M |
panomics
Contact your Panomics Account Executive .. High-throughput assays for protein interactions with PDZ domains .. Rapid-screen for 123 interactions - up to 32 in one assay! .. Economical-no expensive equipment necessary
www.panomics.com/product.php?product_id=29 |
vincibiochem --- Organic Cation Transporters (OCT1-3 and OCTN1-3) Antibodies
m=mouse; r=rat; h=human; ~CT or ~NT=near C or N-terminus. I=Internal peptides. .. Ab Crossreactivity .. Neat Antisera Cat # .. Organic Cation Transporters (OCT1-3 and OCTN1-3) Antibodies
www.vincibiochem.it/ADI/octflr.html |
invivogen --- Plasmocin prot
and prevention of Mycoplasma contamination of cell culture Catalog # ant-mpt, ant-mpp For research use only Version # 02F12-EL PRODUCT INFORMATION In contrast to most anti-
www.invivogen.com/PDF/Plasmocin_TDS_2.pdf |
natutec
Tel: 069 67 73 78 0 Fax: 069 67 73 78 79 info@natutec.com www.natutec. .. CD150+CD244-CD48- cells while non-self-renewing multipotent hematopoietic progenitors (MPP) are CD244+CD150-CD48- and the most restricted progenitors are CD48+CD244+CD150-.
www.natutec.de/pdf_ebioscience/11-2441.pdf |
dutch --- Dutch Diagnostics Reagents TURBI / NEPHELOMETRIC - CALIBRATORS
IGA, IGD, IGG, IGM, C1I, CER, AT3 .. 1 mL Low Level .. AGP, ALB, C3, C4, AAT, HAP, .. 5 mL Low Level .. TRF, FIN, KAP, LAM, PAL, AMG .. 1 mL High Level .. MPS/STH-005 .. 5 mL High Level
www.dutch-diagnostics.com/Calibrators.html |
biosynth --- BIOSYNTH : Amino Acids
More Search Options .. Products Support Orders Your Account Company ? .. HomeFine ChemicalsAmino Acids .. Properties of Amino Acids .. Natural and Non-Natural Amino Acids
www.biosynth.com/index.asp?topic_id=246&g=19&m=294 |
springbio --- Spring Bioscience: Your direct source for IHC products!
For general info contact info@springbio.com. .. Sub Type .. Specs .. melanoma gp100 .. a-1-antichymotrypsin .. full length .. a-1-antitrypsin .. full length .. ACAD8 .. full length
www.springbio.com/index.cfm?p=5&q=9&plid=11 |
genwaybio --- MPP antibody, M-phase phosphoprotein 6 variant Antibody, Chicken IgY Polyclo ...
Protein Expression Services for MPP .. M-phase phosphoprotein 6 variant Antibody, Chicken IgY Polyclonal Antibody .. Buy MPP antibody - .. Gene Name: MPP .. Gene Name Synonym: MPP; MPP6; MPP-6
www.genwaybio.com/product_info.php?products_id=532 more from same supplier |