| Webpages from suppliers (information here can not be filtred).
|
origene --- OriGene - NM_005836 cDNA Clone - Homo sapiens heat-responsive protein 12 (HRSP12) as 10 ug ...
Homo sapiens heat-responsive protein 12 (HRSP12) as 10 ug transfection-ready DNA NM_005836.2 .. HuSH 29mer shRNA Constructs against HRSP12
www.origene.com/cdna/trueclone/accession/NM_005836/SC111142.aspx |
ptglab --- Antibody to HRSP12
PSP; p14.5; UK114 .. Purified Rabbit Anti Human HRSP12 Poly antibody
www.ptglab.com/datasheet.asp?catNo=12930-1-AP more from same supplier |
abcam --- Prostate Secretory Protein/PSP antibody [YPSP-1] see more information about this reagent
ab19070 .. Prostate Secretory Protein/PSP antibody [YPSP-1] .. www.abcam.com/index.html?datasheet=19070
www.abcam.com/index.html?datasheet=19070 more from same supplier |
yesbiotech
Prostate Secretory Protein (PSP), monoclonal anti-human .. YPSP-1
www.yesbiotech.com/antibodies_mabmarkers.htm |
anogen
Prostate Secretory Protein (PSP), monoclonal anti-human .. YPSP-1
www.anogen.ca/antibodies_mabmarkers.htm |
proteinone
RNA Pol II (anti-p14.5) .. hRPB9 is a subunit unique to RNA polymerase II, although it has sequence homologues in .. -p14. .. Each vial contains 100 mg IgG in 0.2 ml of PBS .. -p14.5 reacts with the p14.
www.proteinone.com/order/antibodies_detail.html?serial=PA110-01 more from same supplier |
leinco --- Anti-Human Persephin (PSP) (Antigen Aff. Pur.)
Recombinant Mouse Persephin (PSP) (Leinco Prod. No.: P233) .. Goat Anti-Human Persephin (PSP) .. (PSPN)
www.leinco.com/product?P172 more from same supplier |
acris --- antigen : HRSP12 : H00010247-P01-25 - Datasheets & MSDS - Acris Antibodies - The
Antigen : HRSP12 .. Show all HRSP12 .. Antigen : HRSP12
www.acris-antibodies.com/products/acris/H00010247-P01-25/antigen/HRSP12.html more from same supplier |
abraxiskits
Importance of the Saxitoxin Determination Saxitoxin (PSP) ELISA, Microtiter Plate Saxitoxin is one of the "paralytic shellfish poisons" ( .. Working Instructions The concentrations of the samples are determined using this
www.abraxiskits.com/moreinfo/PN52255BUSER.pdf more from same supplier |
biosense
product for rapid, real time mussel tissue testing and compliments the Saxitoxin (PSP) and our ASP (Domoic Acid) ELISA kits. .. The Okadaic Acid ELISA is an immunoassay for the quantitative and sensitive
www.biosense.com/nettbutikk/render.asp?dsp=gridSelected&searchgroup=alt10&lgusr=&dsct=0&ge ... more from same supplier |
jenabioscience
Transcription Factor Antibodies .. Protein Kinase Antibodies .. Cytokine Antibodies .. Biogenic Amines Antibodies .. Prion Antibodies .. Total Products: 881 .. Total Items: 894
www.jenabioscience.com/cms/0692df485059e0d2069dca8f9d4afaf5/1/catalog/272/index.html more from same supplier |
medicorp
Product Details : ABD-010 ABD-010 .. Description: alpha-RNA Pol II (anti-p14.5)
www.medicorp.com/web/product_details.php?supplier=Jena Biosciences&sup=Jena Biosciences&p_ ... more from same supplier |
europa --- Prostate Specific Protein (PSP) (94) >90%
Tech Info: Remarks / matched Antibody Pairs: human seminal fluid .. Prostate Specific Protein (PSP) (94) 90% .. £650.00 GBP
www.europa-bioproducts.com/products/8829 more from same supplier |
komabiotech
Recombinant human Phosphoserine phosphatase (PSP) .. (1-225aa) purified from E. coli
www.komabiotech.com/shop/dvProduct.phtml?pid=049425_K2011085&pcode=6 |
rndsystems
Reg IA Antibody ORDERING INFORMATION Background Reg IA, also known as PTP, PSP, and lithostathine, is a member of the Reg family of Catalog Number: MAB4937 secreted
www.rndsystems.com/pdf/MAB4937.pdf more from same supplier |
caltagmedsystems
Further information: Antigen Synonyms - ICRF - MGC12447 - P19 - PSP - PSPS - PSPS1 - PTP - REG .. Product Code: H00005967-M01
www.caltagmedsystems.co.uk/pricing_ordering/product_detail.php?CI_ID=142924 more from same supplier |
4adi --- Trefoil factor family TIFF TFF1 tff2 tff3 PSP hSP hITF gastrointestinal estrogens mucins m ...
Home ADI Shop Product ZIP62-A .. ZIP62-A .. ZIP62-A .. Anti-Human Zinc Transporter 6 (ZIP6) IgG #1 (aff pure) 100 ug Antibody Pure IgG .. Data Sheet of Human Zinc Transporter 6 Antibody# ZIP62-A and control peptide #
www.4adi.com/adishop/index.php/action/item/id/3267/prevaction/category/previd/2/prevstart/ ... more from same supplier |
abnova
ICRF, MGC12447, P19, PSP, PSPS, PSPS1, PTP, REG .. REG1A monoclonal antibody (M02), clone 1G10
www.abnova.com/Products/products_list.asp?classid=AFAAAE000000&OwnClass=3&ClassL1=A&ClassL ... |
alomone
protein with a sequence RSKKLEHSNDPFNVY IESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETK PSP, corresponding to residues 67-129 of human KCNE1 (IsK) (Accession P15382). .. Intracellular, C-terminus.
www.alomone.com/p_postcards/database/62.htm |
cedarlanelabs
igbf, msp, mspb, pn44, prps, psp, psp-94, psp57, psp94 .. aah05257
www.cedarlanelabs.com/US/abnova.asp?action=details&pid=H00004477-A01-50UL more from same supplier |
biovendor
Human Reg protein family consists of Reg 1 alpha (also cal ed PSP, Lithostatine, PTP, regenerating gene I), Reg 1 beta/ RegL, HIP/PAP and Reg IV. .. 4.
www.biovendor.com/pdf/RD191078100R_Reg_1_alpha_Human_ELISA.pdf |
ibl
Human Reg protein family consists of Reg 1 alpha (also cal ed PSP, Lithostatine, PTP, regenerating gene I), Reg 1 beta/ RegL, HIP/PAP and Reg IV. .. 4.
www.ibl-america.com/pdf/BioVender/RD191078100R_IBL.pdf |
axxora
JBS-ABD-010 .. [Jena Biosci] .. Revised 01-Jul-08 .. JBS-ABD-010 .. (anti-p14.5 subunit of RNA Polymerase II) .. Polyclonal Antibody to -RNA Pol II
www.axxora.com/rna_polymerases-related_products-JBS-ABD-010/opfa.1.1.JBS-ABD-010.1522.4.1. ... |
feldan
98% by SDS-Page analysis. Endotoxin level is less than 0.1ng per ug (1EU/ug) of human PSP. .. The lyophilized PSP is soluble in water and most aqueous buffers.
www.feldan-bio.com/catalog/index.php?act=viewProd&productId=1481 |
peprotech
Recombinant Human Persephin (PSP) .. Recombinant Human Pleiotrophin
www.peprotech.com/category.asp?category_name=Human,+Murine+&+Rat+Neurotrophins(PeproTech+B ... |
immunodetect
Sony Vaio .. Sony PSP .. Sony Laptop
www.immunodetect.com/buy/sony/play/station/sony.com.htm |
arp1
Recombinant, E. coli. expression systems. Affinity Purified. Size: 50ug .. Phosphoserine Phosphatase (PSP), human .. Product Description: Phosphoserine Phosphatase (PSP), human. Recombinant, E. coli.
www.arp1.com/product_detail.php?p_id=01-2259 |
ibl
Environmental-/food analysis Environmental-/food analysis Saxitoxin (PSP) ELISA .. Saxitoxin (PSP) ELISA .. 50 µL water samples or shellfish sample extracts
www.ibl-hamburg.com/products.0,l.0.cat.Environmental-%2Ffood+analysis.pg.Environmental-%2F ... |
genwaybio --- PSPH protein, Phosphoserine Phosphatase (PSP) Human recombinant protein
Mutations responsible for 3-phosphoserine phosphatase deficiency. .. Phosphoserine Phosphatase (PSP) Human recombinant protein .. Buy PSPH protein -
www.genwaybio.com/product_info.php?products_id=45546 more from same supplier |