ExactAntigen

HRH3 antibody
    synonym: GPCR97; HH3R; HRH3
    description: histamine receptor H3
  antibody  cDNA  ELISA/Kit  protein/peptide  siRNA/shRNA
Filtersremove all filters
suppliers:
AbcamAbnova
Everest BiotechInvitrogen
LifeSpan BiosciencesMBL International
MilliporeNovus Biologicals
Santa Cruz BiotechnologySigma-Aldrich
reactivity: mouse rat dog human
clonality: monoclonal polyclonal
host: mouse goat rabbit
application: immunoprecipitation immunohistochemistry elisa
western blot immunocytochemistry
Select up to five antibodies for comparison.
Anti-H3 Histamine Receptor antibody produced in rabbit
Sigma-Aldrich
reactivity: mouse, rat, human
clonality: polyclonal
host: rabbit
application: immunohistochemistry
quantity:
price:
to the supplier
Goat Anti-Histamine Receptor H3 Antibody
Everest Biotech
reactivity: human
clonality: polyclonal
host: goat
application: elisa
quantity: 0.1 mg
price: 185.00
to the supplier
Histamine H3 Receptor (C-20)
Santa Cruz Biotechnology
reactivity: mouse, rat, human
clonality: polyclonal
host: goat
application: immunoprecipitation, immunocytochemistry, western blot, elisa
quantity: 200 ug/ml
price: $248
to the supplier
Histamine H3 Receptor (H-130)
Santa Cruz Biotechnology
reactivity: mouse, rat, human
clonality: polyclonal
host: rabbit
application: immunoprecipitation, immunocytochemistry, western blot, elisa
quantity: 200 ug/ml
price: $248
to the supplier
Histamine H3 Receptor (N-20)
Santa Cruz Biotechnology
reactivity: mouse, rat, human
clonality: polyclonal
host: goat
application: immunocytochemistry, western blot, elisa
quantity: 200 ug/ml
price: $248
to the supplier
Histamine H3 Receptor (P-15)
Santa Cruz Biotechnology
reactivity: human
clonality: polyclonal
host: goat
application: immunocytochemistry, western blot, elisa
quantity: 200 ug/ml
price: $248
to the supplier
G Protein-Coupled Receptor GPR97 Antibody
Novus Biologicals
reactivity: mouse, human
clonality: polyclonal
host: rabbit
application: immunohistochemistry
quantity: 0.05 ml
price: 325
to the supplier
HRH3 Antibody
Novus Biologicals
reactivity: human
clonality: monoclonal
host: mouse
application: western blot, elisa
quantity: 0.1 ml
price: 275
to the supplier
HRH3 Antibody
Novus Biologicals
reactivity: human
clonality: polyclonal
host: rabbit
quantity: 0.1 mg
price: 285
to the supplier
HRH3 Antibody
Novus Biologicals
reactivity: human
clonality: polyclonal
host: mouse
application: western blot, elisa
quantity: 50 ul
price: 205
to the supplier
Histamine H3 Receptor Antibody
Novus Biologicals
reactivity: mouse, rat, human
clonality: polyclonal
host: rabbit
application: western blot, immunohistochemistry
quantity: 0.05 ml
price: 375
to the supplier
Histamine H3 Receptor Antibody
Novus Biologicals
reactivity: human
clonality: polyclonal
host: rabbit
application: western blot, immunohistochemistry
quantity: 0.05 ml
price: 375
to the supplier
Histamine H3 Receptor Antibody
Novus Biologicals
reactivity: mouse, rat, human
clonality: polyclonal
host: rabbit
application: immunocytochemistry, immunohistochemistry
quantity: 0.05 ml
price: 375
to the supplier
Histamine Receptor H3 Antibody
Novus Biologicals
reactivity: human
clonality: polyclonal
host: goat
application: western blot, elisa
quantity: 0.1 mg
price: 195
to the supplier
Histamine H3 Receptor (HRH3) Rabbit anti-Human Polyclonal Antibody
LifeSpan Biosciences
reactivity: human
clonality: polyclonal
host: rabbit
application: western blot, elisa
quantity:
price:
to the supplier
Histamine H3 Receptor (HRH3) Rabbit anti-Human Polyclonal Antibody
LifeSpan Biosciences
reactivity: human
clonality: polyclonal
host: rabbit
application: western blot, elisa
quantity:
price:
to the supplier
Histamine H3 Receptor (HRH3) Rabbit anti-Human Polyclonal Antibody
LifeSpan Biosciences
reactivity: human
clonality: polyclonal
host: rabbit
application: immunohistochemistry
quantity:
price:
to the supplier
Histamine H3 Receptor (HRH3) Rabbit anti-Rat Polyclonal Antibody
LifeSpan Biosciences
reactivity: human
clonality: polyclonal
host: rabbit
application: western blot, elisa
quantity:
price:
to the supplier
Histamine H3 Receptor (HRH3) Rabbit anti-Rat Polyclonal Antibody
LifeSpan Biosciences
reactivity: human
clonality: polyclonal
host: rabbit
application: western blot, elisa
quantity:
price:
to the supplier
Histamine H3 Receptor Polyclonal Antibody
MBL International
reactivity: human
clonality: polyclonal
host: rabbit
application: immunohistochemistry
quantity: 50 µl
price: 350.00
to the supplier
Histamine H3 Receptor Polyclonal Antibody
MBL International
reactivity: human
clonality: polyclonal
host: rabbit
application: immunohistochemistry
quantity: 50 µl
price: 350.00
to the supplier
Histamine H3 Receptor Polyclonal Antibody
MBL International
reactivity: human
clonality: polyclonal
host: rabbit
application: immunohistochemistry
quantity: 50 µl
price: 350.00
to the supplier
Anti-Histamine H3 Receptor, pain
Millipore
more products
reactivity: human
clonality: polyclonal
host: rabbit
application: immunocytochemistry, immunohistochemistry
quantity: 50 μg
price:
to the supplier
HRH3 antibody
Abcam
more products
reactivity: mouse, rat, dog, human
clonality: polyclonal
host: rabbit
application: western blot, elisa
quantity:
price:
to the supplier
HH3R
Invitrogen
reactivity: human
clonality: polyclonal
host: rabbit
quantity:
price:
to the supplier
HRH3 monoclonal antibody (M01), clone 1D7
Abnova
more products
reactivity: human
clonality: monoclonal
host: mouse
quantity: 100 ug
price:
to the supplier
Webpages from suppliers (information here can not be filtred).
usbio    see more information about this reagent
    You are here: Home Antibodies Abs to G Protein Receptors G Protein Coupled Receptor 97 (GPCR97, GPR97) .. Synthetic peptide corresponding to the 2nd Extracellular Loop of G Protein Coupled Receptor 97 (KLH).
    www.usbio.net/displayPage.php?ProdSku=G8601-01B    more from same supplier
origene --- OriGene - NM_007232 cDNA Clone - Homo sapiens histamine receptor H3 (HRH3) as 10 ug transf ...
    Homo sapiens histamine receptor H3 (HRH3) as 10 ug transfection-ready DNA NM_007232.1 .. HuSH 29mer shRNA Constructs against HRH3
    www.origene.com/cdna/trueclone/accession/NM_007232/SC303895.aspx
caltagmedsystems
    b>Histamine H3 Receptor Polyclonal Antibody - Pur. Ab. (50 µl) .. Product Code: LS-A476
    www.caltagmedsystems.co.uk/pricing_ordering/products_ordering.php?CS_ID=50&CG_ID=11&numrec ...    more from same supplier
cedarlanelabs
    MKMVSQSFTQRFRLSRDRKVAKS .. HRH3 monoclonal antibody (M01), clone 1D7 .. GPCR97, HH3R
    www.cedarlanelabs.com/US/abnova.asp?action=details&pid=H00011255-M01-100UG    more from same supplier
acris
    Alternate names: GPCR97, HH3R, gpcr97, h3 histamine receptor, hh3r, histamine 3 receptor, hrh3 .. Multiple isoforms of H3 receptors are produced by alternative splicing. .. Histamine H3 receptor has been reported primarily in brain.
    www.acris-antibodies.com/products/acris/SP4354P/antibody/Histamine_Receptor_3_(H3R).html    more from same supplier
4adi
    10 20 30 40 50 60 hH3R MERAPPDGPLNASGALAGDAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV hH4R - .. Alignment data :
    www.4adi.com/seqs/hr14seq.html    more from same supplier
vincibiochem
    A third subtype of histamine receptor, human H3R (GPCR97), was finally identified as a presynaptic autoreceptor on histamine neurons in the .. Most recently, a novel orphan G-protein coupled receptor, named H4R (GPRv53, human 390
    www.vincibiochem.it/ADI/histamineflr.html
genetex
    b>HRH3 antibody .. GTX100187
    www.genetex.com/commerce/misc/catalog.jsp?no=t&category_id=0&rowCount=25&sort=&start=26&cz ...    more from same supplier
tocris
    b>Histamine H3 Receptor TocrisetTM .. Selection of 5 histamine H3 receptor ligands (Cat. Nos. 0729, 0569, 0752, 0779 and 0644)
    www.tocris.com/browse.php?View=Summary&Type=Alpha&Value=H
panomics
    b>Hrh3 .. histamine receptor H3
    www.panomics.com/index.php?id=qgpsc&page=61    more from same supplier
openbiosystems
    Histamine receptor H2 .. HRH3 .. Histamine receptor H3
    www.openbiosystems.com/GeneSets/Human/GPCR/index.html
genwaybio --- HRH3 antibody, Histamine H3 receptor Antibody, Rabbit IgG Polyclonal Anti ...
    Cloning and functional expression of the human histamine H3S receptor. .. Histamine H3 receptor Antibody, Rabbit IgG Polyclonal Antibody .. Buy HRH3 antibody - .. Gene Name: HRH3 .. Gene Name Synonym: GPCR97; HH3R
    www.genwaybio.com/product_info.php?products_id=10192    more from same supplier
ExactAlert email me when new information for HRH3 becomes available.


2008©ExactAntigen home | browse | about