| Webpages from suppliers (information here can not be filtred).
|
usbio see more information about this reagent You are here: Home Antibodies Abs to G Protein Receptors G Protein Coupled Receptor 97 (GPCR97, GPR97) .. Synthetic peptide corresponding to the 2nd Extracellular Loop of G Protein Coupled Receptor 97 (KLH). www.usbio.net/displayPage.php?ProdSku=G8601-01B more from same supplier |
origene --- OriGene - NM_007232 cDNA Clone - Homo sapiens histamine receptor H3 (HRH3) as 10 ug transf ... Homo sapiens histamine receptor H3 (HRH3) as 10 ug transfection-ready DNA NM_007232.1 .. HuSH 29mer shRNA Constructs against HRH3 www.origene.com/cdna/trueclone/accession/NM_007232/SC303895.aspx |
caltagmedsystems b>Histamine H3 Receptor Polyclonal Antibody - Pur. Ab. (50 µl) .. Product Code: LS-A476 www.caltagmedsystems.co.uk/pricing_ordering/products_ordering.php?CS_ID=50&CG_ID=11&numrec ... more from same supplier |
cedarlanelabs MKMVSQSFTQRFRLSRDRKVAKS .. HRH3 monoclonal antibody (M01), clone 1D7 .. GPCR97, HH3R www.cedarlanelabs.com/US/abnova.asp?action=details&pid=H00011255-M01-100UG more from same supplier |
acris Alternate names: GPCR97, HH3R, gpcr97, h3 histamine receptor, hh3r, histamine 3 receptor, hrh3 .. Multiple isoforms of H3 receptors are produced by alternative splicing. .. Histamine H3 receptor has been reported primarily in brain. www.acris-antibodies.com/products/acris/SP4354P/antibody/Histamine_Receptor_3_(H3R).html more from same supplier |
4adi 10 20 30 40 50 60 hH3R MERAPPDGPLNASGALAGDAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV hH4R - .. Alignment data : www.4adi.com/seqs/hr14seq.html more from same supplier |
vincibiochem A third subtype of histamine receptor, human H3R (GPCR97), was finally identified as a presynaptic autoreceptor on histamine neurons in the .. Most recently, a novel orphan G-protein coupled receptor, named H4R (GPRv53, human 390 www.vincibiochem.it/ADI/histamineflr.html |
genetex b>HRH3 antibody .. GTX100187 www.genetex.com/commerce/misc/catalog.jsp?no=t&category_id=0&rowCount=25&sort=&start=26&cz ... more from same supplier |
tocris b>Histamine H3 Receptor TocrisetTM .. Selection of 5 histamine H3 receptor ligands (Cat. Nos. 0729, 0569, 0752, 0779 and 0644) www.tocris.com/browse.php?View=Summary&Type=Alpha&Value=H |
panomics b>Hrh3 .. histamine receptor H3 www.panomics.com/index.php?id=qgpsc&page=61 more from same supplier |
openbiosystems Histamine receptor H2 .. HRH3 .. Histamine receptor H3 www.openbiosystems.com/GeneSets/Human/GPCR/index.html |
genwaybio --- HRH3 antibody, Histamine H3 receptor Antibody, Rabbit IgG Polyclonal Anti ... Cloning and functional expression of the human histamine H3S receptor. .. Histamine H3 receptor Antibody, Rabbit IgG Polyclonal Antibody .. Buy HRH3 antibody - .. Gene Name: HRH3 .. Gene Name Synonym: GPCR97; HH3R www.genwaybio.com/product_info.php?products_id=10192 more from same supplier |