| Webpages from suppliers (information here can not be filtred).
|
origene --- OriGene - NM_013326 cDNA Clone - Homo sapiens chromosome 18 open reading frame 8 (C18orf8) ...
Homo sapiens chromosome 18 open reading frame 8 (C18orf8) as 10 ug transfection-ready DNA NM_013326.2 .. HuSH 29mer shRNA Constructs against C18orf8
www.origene.com/cdna/trueclone/accession/NM_013326/SC115282.aspx more from same supplier |
abgent --- MIC1 Antibody (Center) Blocking Peptide
to generate the antibody AP7299c was selected from the Center region of human MIC1. A 10 to 100 fold molar excess to antibody is recommended. .. Uncharacterized protein C18orf8; Colon cancer-associated protein Mic1; Mic-1; C18orf8
www.abgent.com/products/catalog_no/BP7299c/specification more from same supplier |
neuromics --- GDF-15;MIC1;Prostate differentiation factor;PDF;Placental bonemorphogenetic protein;MIC-1; ...
Heregulin-Beta2 .. DATASHEET(pdf - 156Kb) .. Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac .. 2. .. 3. .. 4. .. 5. .. 6. .. Image: Heregulin-B2 structure and sequence
www.neuromics.com/ittrium/visit?path=A1x66x1y1x9fx1y1x62dx1y1x38ccx1x82y1x3a20x1x7f more from same supplier |
lsbio
TGF beta, not assigned-TGF beta, GDF15, MIC-1, MIC1, NAG-1, NRG-1, PDF, PLAB, PTGFB, GDF-15, placental bone morphogenic protein plab
www.lsbio.com/products/GeneDetail.aspx?LSID=3739 more from same supplier |
orbigen
prostate differentiation factor, PDF, MIC1, MIC-1, NAG-1, PTGFB, PTGF-beta, NSAID, nonsteroidal anti-inflammatory drug-activated .. Subramaniam S, Strelau J, Unsicker K: Growth differentiation factor-15 prevents low
www.orbigen.com/commerce/catalog/product.jsp?product_id=1652 |
ptglab
b>C18orf8 .. chromosome 18 open reading frame 8, mRNA (cDNA clone MGC:15190 )
www.ptglab.com/cDNA.asp?page=93 |
abnova
gdf15, mic1, mic1, nag1, pdf, plab, ptgfb
www.abnova.com/Products/products_list.asp?classid=ACAAAF000000&OwnClass=3&ClassL1=B&ClassL ... |
genwaybio
Growth Differentiation Factor 15, GDF-15, Neu Differentiation Factor, PDF, MIC1, PLAB, MIC-1, NAG-1, HRG-2b, NRG1, Placental bone morphogenetic protein, Placental TGF- .. Amino Acid Sequence: shlvkcaekektfcvnggecfmvkdlsnpsrylckcpneftgdrcqnyvmasfykaeelyq
www.genwaybio.com/product_info.php?cPath=3000_3001&products_id=45234 more from same supplier |