Webpages from suppliers (information here can not be filtred).
origene --- Homo sapiens apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1), nuclear gene ... Homo sapiens apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1), nuclear gene encoding mitochondrial protein, transcript variant 3 as 10 ug .. HuSH 29mer shRNA Constructs against PDCD8 www.origene.com/cdna/trueclone/accession/NM_145813/SC100268.aspx more from same supplier
prosci --- AIFAntibody :: Apoptosis Antibodies :: Primary Antibodies :: ProSci ... Description Left: Western blot analysis of AIF in K562 cell lysate (A), mouse (B), and rat (C) liver tissue lysates with AIF .. Below: Immunocytochemistry of AIF in K562 cells with AIF antibody at 5 g/ml. www.prosci-inc.com/shop/product.php?productid=6105&cat=98&page=1 more from same supplier
acris --- antibody : AIF (109-122) : SP6222P - Datasheets & MSDS - Acris Antibodies - ... Nature 1999;397:441-6 SP6222P/AV1105 .. Show all AIF (109-122) .. Antibody : AIF (109-122) www.acris-antibodies.com/products/acris/SP6222P/antibody/AIF_(109-122).html more from same supplier
4adi --- Human AIF protein control Human Apoptosis Inducing Factor (AIF) WB +ve protein control 100 ul Protein Control Protein .. Product Details www.4adi.com/adishop/index.php/action/item/id/3308/prevaction/category/previd/2/prevstart/ ... more from same supplier
caymanchem --- Cayman Chemical AIF Polyclonal Antibody Description Programmed Cell Death Protein 8 ... Purchase 160773 AIF Polyclonal Antibody .. Antigen: human AIF amino acids 151-180 ( RARDPGARVLIVSEDPELPYMRPPLSKELW ) 路 Host: rabbit 路 Cross- .. 1 Lorenzo, H.K., Susin, S.A., Penninger, J., et al. www.caymanchem.com/app/template/Product.vm/catalog/160773/a/z more from same supplier
biochain Anti-AIF1 .. Rabbit Polyclonal Anti-AIF (CT) .. Anti-AIF2 www.biochain.com/biochain/shop3.aspx?sub_category=Primary Antibody&species_name=Apoptosis& ... more from same supplier
mitosciences --- MitoSciences: MSA09 AIF (Apoptosis-Inducing Factor) monoclonal antibody ICC detection of AIF in human fibroblasts. .. AIF monoclonal antibody .. MSA09 www.mitosciences.com/msa09.html more from same supplier
ibl IBL Products AntibodiesAntibodies AIF Polyclonal Antibody .. AIF Polyclonal Antibody .. Synthetic peptide (aa) from human AIF conj. to BSA www.ibl-hamburg.com/products.0,l.0.cat.Antibodies.pg.Antibodies.cn.CM160773.s.1.p.AIF%2520 ... more from same supplier
genetex --- GTX27870-AIF peptide-GeneTex Inc GTX20930 .. AIF peptide .. GTX27870 www.genetex.com/commerce/catalog/product.jsp?product_id=1410 more from same supplier
alphagenix Apoptosis-inducing Factor (AIF)-like Mitchondrion-associated Inducer Of Death (AMID) Rabbit anti-Human Polyclonal .. Apoptosis-inducing Factor (AIFM1, PDCD8) Rabbit Polyclonal Antibody www.alphagenix.com/products.php?pg=8 more from same supplier
genetex --- GTX27870-AIF peptide-GeneTex Inc GTX20930 .. AIF ( internal ) peptide ( human ) .. The peptide is used for blocking the antibody activity of AIF. www.genetex.com/commerce/ccp1410-aif-peptide-2267p-gtx27870.htm more from same supplier
axxora --- Polyclonal Antibody to AIF (IN) - PSC-2267 DNA fragmentation, was identified, cloned, and designated apoptosis inducing factor (AIF) [2]. .. [1] Condensed matter in cell death: G. Kroemer & N. www.axxora.com/mitochondrial_pathway-PSC-2267/opfa.1.1.PSC-2267.1073.4.1.html more from same supplier
qedbio QED Bioscience Inc. A D V A N C E D A N T I B O D Y T E C H N O L O G I E S Anti-AIF (CT) Antibody ORDERING INFORMATION SPECIFICATION SUMMARY Catalog No. www.qedbio.com/pdf/named/AIF (CT) 2301.pdf more from same supplier
biocat Home - Protein Analysis - Primary Antibodies - Apoptosis Related Proteins .. AIF Polyclonal Antibody .. Home - Protein Analysis - Primary Antibodies - Apoptosis Related Proteins www.biocat.de/cgi-bin/adm/prod.pl?prod=3202-100-BV
hypromatrix --- Microsoft Word - AIF.doc Biol. Chem. .. www.hypromatrix.com anti-AIF 7. www.hypromatrix.com/Products/Primary_Antibody/AIF.pdf
antibodyresearch b>AIFM1 - Apoptosis-inducing Factor ( PDCD8) .. AMID - Apoptosis-inducing factor (AIF)-like mitchondrion-associated inducer of death www.antibodyresearch.com/files/antibodies_all_page_a.html
vincibiochem reverse transcriptase activity and 14-3-3 protein binding ability, IHC used 1:3K; also AIF/mab. .. Telomerase/Est2 Hiyama E 2003 Cancer Lett. www.vincibiochem.it/ADI/telomerase.html more from same supplier
genwaybio --- AIFM1antibody, AIF Antibody, Rabbit IgG Polyclonal Antibody DNA binding is required for the apoptogenic action of apoptosis inducing factor. .. AIFAntibody, Rabbit IgG Polyclonal Antibody .. Buy AIFM1antibody - .. Gene Name: AIFM1 .. Gene Name Synonym: AIF; PDCD8 www.genwaybio.com/product_info.php?products_id=196801 more from same supplier
ExactAlert
email me when new information for AIFM1 becomes available.