synonym: Calr
description: calreticulin |
|
|
|
| Webpages from suppliers (information here can not be filtred).
| origene --- OriGene - NM_004343 cDNA Clone - Homo sapiens calreticulin (CALR) as 10 ug transfection-re ...
ORF Clone of Homo sapiens calreticulin (CALR) as 10 ug transfection-ready DNA .. Homo sapiens calreticulin (CALR) as 10 ug transfection-ready DNA NM_004343.2 .. HuSH 29mer shRNA Constructs against CALR
www.origene.com/cdna/trueclone/accession/NM_004343/SC107910.aspx more from same supplier | usbio --- Calreticulin Pab Rb xMo
Calreticulin Pab Rb xMo .. Supplied as a liquid in PBS, pH 7.2, 0.05% sodium azide. .. Abs to Ion Channel
www.usbio.net/Product.aspx?ProdSku=C1036-02A more from same supplier | natutec --- Calreticulin Antibody AbVantage Pack
Calreticulin Antibody AbVantageTM Pack Affinity Purified Anti-CALR Antibody, Anti-Calreticulin Antibody, Anti-SSA Antibody, Anti- Ro < .. Calreticulin Antibody Affinity Purified Anti-CALR Antibody, Anti-Calreticulin Antibody, Anti-SSA
www.natutec.de/pdf_bethyl/A310-372A.pdf more from same supplier | bethyl --- Calreticulin Antibody Bethyl Laboratories
Rabbit anti-Calreticulin Antibody, Affinity Purified .. CALR, calreticulin, SSA,Sicca syndrome antigen A, Ro, autoantigen Ro. .. Rabbit anti-Calreticulin Antibody, Affinity Purified
www.bethyl.com/go/index.html?product%2FA301-130A more from same supplier | openbiosystems --- Antibody Data for ab14234 (CALR)
Datasheet for Abcam Antibody ab14234 .. CALR (Hs.515162) - Calreticulin .. Chicken polyclonal to Calreticulin - ER Marker .. Synthetic peptide: AEKQMKDKQDEEQRLKEDKKRKEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL, corresponding to
www.openbiosystems.com/AntibodyData/AntibodyData.aspx?abid=ab14234 more from same supplier | axxora --- Calreticulin Antibody AbVantage Pack - BET-A310-372
Revised 21-Sep-07 .. Calreticulin Antibody AbVantage Pack .. Calreticulin/Related Products .. Kits & Sets > Sets > Panels/Sets / Stress & Heat Shock Proteins > Endoplasmatic Reticulum Stress / Protein Synthesis, Modification &
www.axxora.com/cell_death_-_apoptosis_-_autophagy-BET-A310-372/opfa.1.1.BET-A310-372.1013. ... more from same supplier | prosci --- Microsoft Word - XW-7065.doc
prosci-inc.com techsupport@prosci-inc.com CALR Antibody Calreticulin CATALOG NO.
www.prosci-inc.com/shop/pdf/XW-7065.pdf more from same supplier | abnova --- CALR Pre-design Chimera RNAi-Abnova Corporation
CALR monoclonal antibody (M01), clone 1G11-1A9 .. CALR Pre-design Chimera RNAi .. Antigen processing and presentation .. Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in
www.abnova.com.tw/product_search/PS_detail_RNAi.asp?catalog_id=H00000811-R01&category=Nucl ... more from same supplier | caltagmedsystems
Product Code: SR-226C .. Home Products > Products for Cell Biology > Cellular Stress .. There are 292 products in this selection. .. Calcineurin A Polyclonal Antibody - WB - IP (100 µg)
www.caltagmedsystems.co.uk/pricing_ordering/products_ordering.php?CS_ID=44&CG_ID=11&numrec ... more from same supplier | perkinelmer --- IMMUNO-CATCH’ KIT Manual
PerkinElmer Life and Analytical Sciences, Inc. .. TABLE OF CONTENTS I. STORAGE OF KIT COMPONENTS 3 II. INTENDED USE 3 III. INTRODUCTION 3 IV. .. I. STORAGE OF KIT COMPONENTS Upon arrival store the kit components at 2-8 şC.
las.perkinelmer.com/content/Manuals/MAN_ImmunoCatchKit.pdf | biocat
ARP30113_T100-AV .. Anti-Calreticulin precursor (CALR), Antibody, Species Reactivity: Human, Applications: Western Blot .. ARP30113_T100-AV
www.biocat.de/cgi-bin/adm/prod.pl?prod=ARP30113_T100-AV more from same supplier | raybiotech --- GOAT ANTI CALRETICULIN, With HRP-conjugated secondary antibody see more information about this reagent
GOAT ANTI CALRETICULIN, With HRP-conjugated secondary antibody .. www.raybiotech.com/antibody/DS-PB-00345.pdf .. Immunological assay,ELISA, Western Blot, Immunostaining, epitope, detection, inhibition,
www.raybiotech.com/antibody/DS-PB-00345.pdf | acris --- antibody : CALR (calreticulin) : ARP30113_T100 - Datasheets & MSDS - Acris Antib ...
ARP30113_T100 .. Show all CALR (calreticulin) .. Antibody : CALR (calreticulin)
www.acris-antibodies.com/products/acris/ARP30113_T100/antibody/CALR_(calreticulin).html more from same supplier | researchd --- ION TRANSPORT antibodies (Calreticulin) from Research Diagnostics Inc
RETURN (ion transport data page) .. rev:January 11, 2004 .. Return (ion transport data page) .. Rabbit anti-Calreticulin ab (human/ rabbit/ rat) .. Background: Calreticulin is the major binding protein found in smooth muscle sarcoplasmic reticulum (SR) and non-
www.researchd.com/rdiabs/calrtcn.htm | genetex
GTX29613 .. Product No. GTX20000 .. show: 25 50 100 1-25 of 5345 next 25 .. Scavenging Receptor SR-BI antibody .. Calreticulin antibody-ER Marker .. Neurokinin 3 Receptor NK3 antibody
www.genetex.com/commerce/misc/catalog.jsp?sort=GTX2&tabid=-1&category_id=0&czuid=119948446 ... more from same supplier | ptglab --- Fusion protein to CALR datasheet
Fusion protein to CALR .. Fusion protein to CALR .. calreticulin, mRNA (cDNA clone MGC:2227 IMAGE:3050717), complete cds .. CALRETICULIN; CALR; AUTOANTIGEN Ro; RO; CALREticulin precursor; CRP55; HACBP; ERp60; crtc; SSA; CC1QR; Sicca syndrome
www.ptglab.com/agdatasheet.asp?catNo=ag0325 more from same supplier | promab
Albany, CA 94706 USA. Tel: 1-866-339-0871. Fax: 510-740-3625. Email: info@promab.com .. Polyclonal Antibody to Calreticulin .. Lot number .. Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in
www.promab.com/detail_mab.asp?product_id=230 more from same supplier | cosmobio
HS- 049 ) Array Layout ABCB10 ABCB7 ACO1 ALAS1 ATOX1 ATP7A ATP7B B2M 1 2 3 4 5 6 7 8 CALR CAT CCS CD163 CP CYBRD1 DIO1 DNAJA1 9 10 11 12 13 14 15 16 EGR1 FECH FMO3 FOS FRDA FTH1 .. 9 Hs.353170NM_004343 CALR Calreticulin Calreticulin 10 Hs.
www.cosmobio.co.jp/product/products_SPA_20040818/datasheet/HS-049_table.pdf | qedbio
to that used in the assay system. .. QED Bioscience Inc.
www.qedbio.com/pdf/56259.pdf | biolynx --- MJS BioLynx - Assay Designs Promotion
Cannot be combined with any other offers or discounts .. Calnexin pAb .. ADISPA860D .. Calreticulin pAb .. ADISPA600D .. Caspase-6 pAb .. ADIAAP106E .. Caspase-9 pAb .. ADIAAP149C .. CD74 mAb (Clone #PIN.1)
www.biolynx.ca/Promos/EOY112607.htm | gentaur
GENTAUR ANTIBODIES APOPTOSIS Apoptosis 2 .. TRAIL Polyclonal Ab (Reference #3045-100) 100 ug BIOVISION .. Lamin B1 Monoclonal Ab (Reference #3046-100) 100 ug BIOVISION .. DFF45 Polyclonal Ab (Reference #3047-100) 100 ug BIOVISION
www.gentaur.com/acatalog/GENTAUR_Apoptosis_2_197.html | accuratechemical
Calponin, Clone: CP-93, Mab anti-Human .. Calponin, Clone: hCP, Mab anti- .. Calreticulin, ~63kD, Clone: FMC75, Mab anti-Human, Hamster, Monkey; WB/IP/ICC/IHC/EIA/FACS .. Calreticulin, ~63kD, Clone: FMC75, Mab anti-Human, Hamster, Monkey; WB/IP/ICC/IHC/EIA/FACS
www.accuratechemical.com/browse.asp?letter=C&page=12 | biologo
5 Culina,S., et al. Calreticulin promotes folding of functio.. .. Art.Nr.: Y-21446 Price: 480 € / 0.1 mg .. Human, mouse, rat, rabbit, bovine, and many other species .. FUNCTION: Molecular calcium binding chaperone promoting folding, oligomeric assembly and quality control in
www.biologo.de/englisch/standard/1654/Forschung/Y-21446.html more from same supplier | cedarlanelabs
CAPZA1 Recombinant Protein (P01) .. CALML3 Recombinant Protein (P01) .. CALR Recombinant Protein (P01) .. CALR Recombinant Protein (P01) .. CALR Recombinant Protein (P01)
www.cedarlanelabs.com/US/abnova.asp?action=browse&cid=90&page=23 | rndsystems
It also trans-interacts with SREC-II through the extracellular EGF repeats. .. Monoclonal Anti-human SREC-I Antibody ORDERING INFORMATION Background Scavenger Receptor
www.rndsystems.com/pdf/MAB2409.pdf | genwaybio --- GOAT ANTI CALRETICULIN antibody, GOAT ANTI CALRETICULIN Antibody, Goat IgG P ...
GOAT ANTI CALRETICULIN Antibody, Goat IgG Polyclonal Antibody .. Buy GOAT ANTI CALRETICULIN antibody - .. NCBI Acc #: P83003.1 .. APPLICATIONS for GOAT ANTI CALRETICULIN ANTIBODY:
www.genwaybio.com/product_info.php?products_id=76352 more from same supplier |
|
| ExactAlert | email me when new information for rat calreticulin becomes available. | | |
|