| Webpages from suppliers (information here can not be filtred).
|
usbio
Toll Like Receptor 2 (TLR2, CD282) .. You are here:Home Antibodies Abs to Toll Like Receptors (TLR) .. TLR6 (Toll Like Receptor 6) .. TLR6 (Toll Like Receptor 6) .. TLR6 (Toll Like Receptor 6)
www.usbio.net/displayPage.php?Category=Antibodies&subCategory=Abs to Toll Like Receptors ( ... |
origene --- OriGene - NM_138636 cDNA Clone - Homo sapiens toll-like receptor 8 (TLR8) as 10 ug transfe ...
Homo sapiens toll-like receptor 8 (TLR8) as 10 ug transfection-ready DNA NM_138636.2 .. HuSH 29mer shRNA Constructs against TLR8 .. shRNA Constructs against Mus musculus Tlr8
www.origene.com/cdna/trueclone/accession/NM_138636/SC306054.aspx more from same supplier |
ab --- Toll-Like Receptor 8 - AbD Serotec
Toll-like Receptor Home .. Toll-Like Receptor 8 .. The Toll-like Receptor Family Toll-Like Receptor 8 .. TLR8 is similar to TLR7 in that it is also the receptor for ssRNA. .. ExPASy: Human TLR8 - Q9NR97
www.ab-direct.com/antibodies/toll_like_receptor_8-680.html more from same supplier |
abgent --- Abgent - Chromatin and Regulation Antibodies - chromatin_regulation
10239 Flanders Court, San Diego, CA 92121, USA. Tel: 858.622.0099 Contact Us .. --Choose field-- Keywords Product Name or Cat # All Fields --Product Type-- Monoclonal .. Advanced Search
www.abgent.com/products/category/nuclear_signaling/chromatin_regulation more from same supplier |
caltagmedsystems
Product Code: JM-3633-100 .. Home Products > Products for Cell Biology > Cell Surface Antigens .. There are 861 products in this selection. .. Mouse anti Human TLR7 monoclonal antibody (M10) - mono ascites (100 µg)
www.caltagmedsystems.co.uk/pricing_ordering/products_ordering.php?CS_ID=43&CG_ID=11&numrec ... more from same supplier |
capralogics --- Toll-Like Receptor 8 (TLR8)
2007 Capralogics, Inc. .. Human Toll-like receptor 8 (TLR8) .. Product Number CIO160 .. 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-
www.capralogics.com/CIO160.htm more from same supplier |
activemotif
Guarantee: This product is guaranteed for 6 months from date of receipt. .. YOUR CART 305 Items Check Out .. 120 kDa .. TLR8 mAb .. Background: TLR8 is a member of the Toll-like receptor family.
www.activemotif.com/catalog/details/40955.html more from same supplier |
acris
Back] Pages: [1]-[2]-[3]-[4]-[5]-[6] [ .. Antibodies to Toll-Like Receptor (TLR) Family Products: TLR .. show all Bov Can Chimp Eq GP Hu Marmoset Mky Ms Por Rt Sh .. show all Enzyme Immunoassay Flow Cytometry Frozen Sections Functional Assay
www.acris-antibodies.com/focus_review/focus0004-TLR.php more from same supplier |
biosignatures --- CIM Antibody Core: Tlr8 antibody
Accession Number: AAF78036 .. Tlr8 .. Antibody Name/Abbreviation: TLR8 .. CIM Antibody Core Code: A0020 .. "Lot" Number: 1 Status: Position: 21-120 .. % Identical Homology of Target to Mouse Protein: 65% (NP_573475.1 toll-like receptor 8)
www.biosignatures.org/antibody/west/sp10_Homo_sapiens/311_Tlr8.htm more from same supplier |
abnova
MGC119599, MGC119600 .. TLR8 [X] .. TLR8 monoclonal antibody, clone 44C143 .. Mouse monoclonal antibody raised against synthetic peptides of TLR8.
www.abnova.com/products/new_products.asp?Year=2008&Month=01&Week=&Ckey1=&Ckey2=51311 more from same supplier |
biochain
www.biochain.com Anti-TLR8 (IN) CATALOG No.
www.biochain.com/biochain/coa/Z5020185.pdf |
qedbio
A D V A N C E D R E S E A R C H T E C H N O L O G I E S Toll-like Receptor 8 (TLR8) Polyclonal Antibody ORDERING INFORMATION APPLICATIONS Catalog No.
www.qedbio.com/pdf/Neuroscience/56508 Toll-like Receptor 8.pdf more from same supplier |
kamiyabiomedical --- Microsoft Word - PC-447 TLR8.doc
KAMIYA BIOMEDICAL COMPANY Rev. 022607 PRODUCT DATA SHEET Product: Anti-TLR8 (IN) pAb Cat. No.
www.kamiyabiomedical.com/pdf/PC-447.pdf more from same supplier |
biocat
BAP29 (C-terminal) Polyclonal Antibody, Species Reactivity: Human, Mouse Rat, Tested Application: Western .. BAP29 (internal) Polyclonal Antibody, Species Reactivity: Human, Mouse Rat, Tested Application: Western & IHC.
www.biocat.de/cgi-bin/adm/sub2.pl?sub1=primary_antibodies&sub2=toll-like_receptors&main_gr ... |
invivogen --- Toll-Like Receptor 8
pzero-mtlr8-ha .. 3687 items .. JUL 05, 2008 .. TLR8 Genes .. TLR8 Expressing Cell lines .. 293/TLR-HA Clones .. THP1-Blue Clones .. RAW-Blue™ Cells .. TLR7/8 Ligands
www.invivogen.com/family.php?ID=34&ID_cat=2&ID_sscat=98 more from same supplier |
ebioscience --- eBioscience: human tlr8 Product Information
Product Information Request .. Search Results .. There are no products matching 'human tlr8'. You may want to re-try the search using fewer keywords. .. If you require a new format/conjugate of an existing eBioscience product:
www.ebioscience.com/ebioscience/search.asp?find_spec=human+tlr8&search=YES&find_exact= more from same supplier |
vincibiochem --- Toll-Like Receptors
Tel. 0571 568 147 .. NEW!! Innate Immunity. Pattern Recognition Receptors Inflammation 36 pagine .. Scarica pdf (3. .. Toll-like Receptors Related Products .. Innate Immunity
www.vincibiochem.it/TollLikeReceptors.htm more from same supplier |
immunok
1 mg E, WB 222-25-1TLR9C 170 250 380 TLR9 N term (a.a. 110-125) pAb Purified 0. .. Web: www.ImmunoK.com Email: IKinfo@amsbio. .. ) Description Label Quantity Applications Cat # List Prices GBP £ EURO SFr Mouse TLR8 C term (a.a. 972-988) pAb Purified 0.1 mg E 222-25-1TLR8C 170 250 380 TLR8 N term (a.a.
www.immunok.com/pdfs/IK_mouse_TLR_range.pdf more from same supplier |
alphagenix
Previous..90 91 92 93 94 95 96 97 98 99 100.. Next .. Toll-like Receptor 6 (TLR6) Rabbit anti-Human Polyclonal Antibody .. Area of Research: Toll-like Receptors .. Toll-like Receptor 8 (TLR8) Rabbit anti-Human Polyclonal Antibody
www.alphagenix.com/products.php?cat=7&pg=93 more from same supplier |
medicorp
Description: TLR8 .. Description: ARH/LDL Receptor Adaptor Protein .. Description: Claudin 14 .. Description: Pericentrin 1/Nup75 .. Description: Androgen Receptor
www.medicorp.com/web/suppliers.php?supplier=Imgenex&sup=Imgenex&p_cat=0&page=99 more from same supplier |
biologo
5 Hornung,V., et al. Quantitative expression of toll-like rec.. .. Art.Nr.: Y-22789B Price: 480 € / 0.1 mg .. Toll-like receptor 7 (TLR7) .. FUNCTION: Participates in the innate immune response to microbial agents.
www.biologo.de/englisch/standard/2484/Forschung/Y-22789B.html more from same supplier |
biotrend --- TLR8 (Toll-Like Receptor 8) (IN) see more information about this reagent
PSI3281 .. TLR8 (Toll-Like Receptor 8) (IN) .. Ig Fraction
www.biotrend.com/search/?search_text=PSI3281 more from same supplier |
bendermedsystems --- BenderMed Systems: Literatur Details - human IFN-alpha Instant ELISA
Impaired maturation and altered regulatory function of plasmacytoid dendritic cells in multiple .. Stasiolek,Mariusz; Bayas,Antonios; Kruse,Niels; Wieczarkowiecz,Anja; Toyka,Klaus V.; Gold,Ralf; Selmaj,Krzysztof
www.bendermedsystems.com/products/BMS216INST&c=1 more from same supplier |
exalpha
Survivin (CT) (TIAP) (Inhibitor of Apoptosis) .. 3T3 cells (RSV-transformed) .. Acid Sphingomyelinase .. Syn 211 .. Heterogeneous Nuclear Ribonucleoprotein K .. Human TNF alpha
www.exalpha.com/Searchresults1.php?SearchTerm=Q-Z&menuvalue=AlphaPos |
natutec
Product Information Contents: Affinity Purified anti-mouse/human Toll-like receptor 8 (TLR8, TLR-8) Catalog Number: 14-9089 Sizes: 10 ug, 50 ug Formulation: Phosphate buffer pH 7.
www.natutec.de/pdf_ebioscience/14-9089.pdf |
panomics
DDR1 .. discoidin domain receptor family, member 1 .. CD14 antigen .. Tlr8 .. toll-like receptor 8 .. MAPK3 .. mitogen-activated protein kinase 3 .. Muc5ac .. Mucin 5, subtypes A and C, tracheobronchial/gastric
www.panomics.com/index.php?id=qg2plexsc&page=91 |
genwaybio --- MGC119599 antibody, CDNA FLJ90636 fis, clone PLACE1003737, highly similar to Toll-l ...
Gene Name: MGC119599 .. Gene Name Synonym: MGC119599; MGC119600 .. NCBI Acc #: NP_619542.1 .. Swiss Prot Acc #: Q8NC00 .. Chrom Location: Xp22 .. APPLICATIONS for MGC119599 ANTIBODY:
www.genwaybio.com/product_info_popup.php?products_id=15180 more from same supplier |