| Webpages from suppliers (information here can not be filtred).
|
origene --- OriGene - NM_181310 cDNA Clone - Homo sapiens interleukin 22 receptor, alpha 2 (IL22RA2),
Homo sapiens interleukin 22 receptor, alpha 2 (IL22RA2), transcript variant 3 as 10 ug transfection-ready DNA NM_181310.1 .. HuSH 29mer shRNA Constructs against IL22RA2
www.origene.com/cdna/trueclone/accession/NM_181310/SC307271.aspx more from same supplier |
lsbio
CRF2-S1, CRF2X, IL-22BP, IL-22R-ALPHA-2, IL22BP, interleukin 22 receptor, alpha 2 .. Class II Cytokine Receptor (IL22RA2) Goat anti-Human Polyclonal Antibody .. Class II Cytokine Receptor (IL22RA2) .. IL22RA2, CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-ALPHA-2, IL22BP, interleukin 22 receptor, alpha 2
www.lsbio.com/products/GeneDetail.aspx?LSID=197295 more from same supplier |
capralogics
anti-human IL-22R-alpha 2 .. antibodyinfo@capralogics.com .. Product Number CIO150 .. Goat .. Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N- .. Sequence Alignment
www.capralogics.com/CIO150.htm |