Dihydrodigoxin Date: 2008-05-08 reply " Looking for supplier of Dihydrodigoxin, CAS# 5297-10-9." |
Fzd4 inhibitor Date: 2008-05-03 reply " I have a question. Is it possible to specifically suppress the signaling transduction through Fzd4 other than RNA interference? We would like to find a
reagent specifically block Fzd4's function. Could you give us an indication?
" |
Ethoformsate Date: 2008-04-28 see replies reply " I'd like to find a supplier of Tramat or Norton (both have the active ethoformsate)" |
dihydrodigoxin Date: 2008-04-23 reply " Dihydrodigoxin" |
cardiac troponin I and also troponin antigen Date: 2008-04-18 see replies reply " I would like to know the details and cost of human cardiac troponin I and also troponin antigen" |
hepatitis C virus (HCV) mimitop or antigen Date: 2008-04-17 see replies reply " I required the hepatitis C virus (HCV) mimitop or antigen for mice immunization to prepared a monoclonal antibodies.
Can you supply to us mimitop or antigen of the HCV for mice immunization" |
Pyrrolizidine alkaloid (Lycopsamine) Date: 2008-04-17 reply " I need one or all of the purified plant-derived monester pyrrolizidine alkaloids: lycopsamine/intermedine or echinatine" |
benzyl amine Date: 2008-04-16 reply " sir i am working on moringa oleifera i need the standard of moringine as i will isolate from Moringa oleifera" |
PHF10 Antibody Date: 2008-04-11 see replies reply " Antibody to PHF10" |
coformycin Date: 2008-04-10 reply " looking for a source of coformycin" |
Cadusafos: Date: 2008-04-01 see replies reply " Cadusafos: Where can i order it from? Analytical grade." |
acetadol Date: 2008-03-24 reply " i am an indonesian student
i want to know about companies that produce acetadol and what is the capacity...
also want to know about companies that produce acetadol and what is the capacity...
thx" |
sperm mitochondria associated cysteine rich protein antibody Date: 2008-03-20 see replies reply "I am PhD student at Jalok hospital and research centre (mumbai. india)
i need antibody against sperm mitochondria associated cysteine rich protein
(its very urgent). Kindly send the quotes." |
anp eia kit Date: 2008-03-18 see replies reply " I need elisa 96 well kit for ANP" |
CYP2C8 and CYP3A4 microsomal preparations Date: 2008-03-10 reply " I want to know is the CYP2C8 and CYP3A4 microsomal preparations are availble for rat and rabbit animal models" |
MUC1 or EGFR Date: 2008-03-04 reply "aptamer for MUC1 or EGFR target of lung cancer" |
apiol Date: 2008-02-28 reply " Seeking supply of apiol for R&D purposes" |
vinburnine Date: 2008-02-28 reply " I need to source vinburnine for a SA customer and would need between 1-3 kg at a time. Please contact me urgently." |
piperitenone Date: 2008-02-21 see replies reply " I need pure piperitenone and also essential oil isolated from any kind of mentha species rich in piperitenone (at least 50%). " |
2'2'2'-tribromethanol Date: 2008-02-20 reply " 2'2'2'-tribromethanol for preparing avertin (without performing the decrystallation procedure)" |
Monoclonal antibodies for DNA-RNA hybrid complexes Date: 2008-02-20 see replies reply " Monoclonal antibodies for DNA-RNA hybrid complexes conjugated to biotin or alkaline phosphatase" |
AChR antibody, reactive mouse, gamma and epsilon subunit Date: 2008-02-08 see replies reply " I am looking for antibody against mouse nicotinic acetylcholine receptor epsilon and gamma to do immunohistochemistry." |
pdgfrb in catt;e Date: 2008-02-06 reply " any Platlet derived growth factor receptor beta that works in bovine" |
beta-mannosidase supplier - assay and enzyme Date: 2008-01-31 see replies reply " I am looking for a supplier that supplies an assay for beta-mannosidase as well as pure beta-mannosidase - does anyone supply this? Regards, D" |
gramicidin S Date: 2008-01-30 see replies reply " I need Gramicidin S for my study, please, contact me, in a case you can produce it.
Gramicidin S is a cyclic peptide with two identical pentapeptides joined head to tail, where each half is Val-Orn-Leu-D-Phe-Pro. Orn is like lysine but with one less CH2, and It has D-Phe rather than L Waiting for you answer,
Natalia." |
gramicidin S Date: 2008-01-30 see replies reply " I need Gramicidin S for my study, please, contact me, in a case you can produce it. Gramicidin S is a cyclic peptide with two identical pentapeptides joined head to tail, where each half is Val-Orn-Leu-D-Phe-Pro. Orn is like lysine but with one less CH2, and It has D-Phe rather than L Waiting for you answer,
Natalia." |
TIMP 1 antibody/inhibitor Date: 2008-01-24 see replies reply " I'm a graduate student doing an experiment in which I desire to inhibit the activity TIMP-1 in vitro. Are there any antibodies available for that purpose?" |
semapimod or CNI-1493 Date: 2008-01-18 reply " CNI-1493 or semapimod needed to block Hypusination of eIF5A by Deoxyhypusine synthase in pancreatic cell lines and islets for identification of hypusination dependent molecular targets " |
anti-crestin Date: 2008-01-15 see replies reply " crestin is a marker of neural crest cell of zebrafish.
I want to get anti-crestin." |
galangin standards for HPLC in india Date: 2008-01-10 reply " where can i get the galangin standards for HPLC in india" |
batrachotoxin Date: 2008-01-08 reply " We're looking for batrachotoxin for experimentation. Urgent." |
I need antibodies Date: 2008-01-07 see replies reply "I am a postgraduate from peking univesity shen zhen hospital.I plan to do some experiments on sperm motility,So I need some antibodies used for western blot and immnofluorescence against Bbs2 Bbs4 Mkks Dnahc7 Tekt2 Neur1 Vdac3 Pacrg Agtpbp1 Jund1 Poll Pafah1b1 PGs1 Ttll1 AKap4 Pvr12(Nectin-2) Sept4 Sepp1 Gopc and Krt-1。If you have the antibodies ,I wish you would send me the specific product information immediately,thank you." |
Mouse pancreas beta-Islet-Specific protein Date: 2008-01-03 reply " Mouse Islet-Specific Glucose-6-Phosphatase or any pancreatic beta-islet specific protein from mouse. " |
DIOXITOL Date: 2007-12-23 reply " We need DIOXITOL AU on regular basis bulk quantities.Pl.contact us." |
vibrio furnissii Date: 2007-12-21 reply " i need a culture of vibrio furnissii" |
metalloproteinase elisa kit Date: 2007-12-18 see replies reply " metalloproteinase elisa kit" |
Human health care Date: 2007-12-15 reply " 1.Inj.IOPAMIDOL 2.inj.Haparin 3.inj.Hyaluronic acid.All suppliers / company (Exporter) Name and address" |
adrenaline ,noradrenaline and dopamine Date: 2007-12-11 reply " myself Dr A.K.MISHRA undergoing a research project regarding catecholamine.for the same ,there is need of adrenaline ,noradrenaline and dopamine pure or in injection form.
i will be highly thankful to you for arranging the same or for providing information about supplier of above mentioned chemicals.
with regards
Dr.A.K.Mishra" |
Human MASP2 Date: 2007-12-10 reply " I need to purchase purified human MASP2" |
GMP manufacturing Date: 2007-12-08 see replies reply " GMP manufacturing of recombinant protein upto 300 mg" |
Lymicycline Date: 2007-12-06 reply " We have the requirement of Lymicycline So, if you have the same Please offering us & arrange to send us 500gm sample along with its specification. We need urgently.
" |
ingredients Date: 2007-12-01 reply " we are looking intrested buyer for wild naturel "marine plants,coastal plants,salt marshes plants"." |
purified p17 antigen of HIV-1 Date: 2007-11-27 see replies reply " Hi. I am a research scientist working at the University of Malta, and am looking for a protein production that is commercially available..
This being: ANTIGEN p17 matrix protein of HIV-1 (SEQ ID No:2)
Could you kindly supply me with a quote, and quantity and cost for such a reagent. Thanks!
Kind regards
" |
PLEASE I NEED IT Date: 2007-11-14 reply " TO WHOM IT MAY CORRESPOND,
I WRITE YOU IN ORDER TO KNOW IF YOU CAN DONATE ME GOAT ANTI RAT LEPTIN, ALEXA FLUOR 647, MOUSE MONOCLONAL ANTI RAT LEPTIN RECEPTOR, ALEXA FLUOR 488 OR 405 ANTI MOUSE, BECAUSE MY GRANT FINISHED AND I NEED SOME EXPERIMENTS TO COMPLETE ONE PAPER. IF CAN DONATE IT TO ME I WILL PUT YOU IN THE THANKFULLS AND I VERY GRATEFULL.
SINCERELY
Dr. OSCAR A. BROWN
INSTITUTO DE INVESTIGACIONES CIENTIFICAS DE LA PLATA (INIBIOLP),
FACULTAD DE CIENCIAS MEDICAS, CALLE 60 Y 120 P.O. BOX 455
(1900) LA PLATA, BUENOS AIRES, ARGENTINA.
oabrown@iwinds.com.ar
" |
Maltase Glucoamylase antbiody Date: 2007-11-07 see replies reply "I am searching for either and anti-human or anti-mouse (polyclonal or monoclonal)to Maltase Glucoamylase (Brush border enzyme) for western blots. " |
pea-15 antibody Date: 2007-11-05 see replies reply " antibody pea-15, applications wb and ihc , reactivity with human and rabbit" |
isosorbide Date: 2007-11-05 reply " I would like to purchase HYPEROSMOTIC isosorbide (*not mononitrate, or dinitrate). I believe the name is either hydronol or ismotic. Thanks " |
CML1 antibody Date: 2007-10-30 see replies reply " CML1 antibody" |
antibody against Cordon -bleu protein like 1 Date: 2007-10-30 reply " I need an antibody against Cordon -bleu protein like 1" |
septins/ephrin receptors Date: 2007-10-24 see replies reply " I am looking for antibodies that could recognise the following epitopes: 1) DRTEAGIKRFLEDTT
2) VKERNRNKLTRESGT 3) the SAM domain of the ephrin receptor 2B , peptide sequence QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIP
DYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQ
IQSVEV. In particular I am interested in antibodies that could discriminate between methylated and un-methylated proteins (non-histones). Any advise would be welcome. Many thanks in advance, patricia
" |
Jade1 antibody Date: 2007-10-18 reply " I am looking for an antibody against the Jade1 protein. Thank you!" |
haloprogin Date: 2007-10-17 reply " I'm looking for a source for haloprogin 1% for use in a new antifungal medication-----it's tough to find! Any ideas? Thx--Jane" |
anti rat ccl13 antibody Date: 2007-10-12 see replies reply "Hello,
I am looking for a ccl13 antibody for immunohistochemistry purpose in rat. Does anyone offer that ?
Thank you !
Veronique" |
fab/fab-2 fragments of anti-blood group antibodies Date: 2007-10-01 see replies reply " can any company supply fab/fab-2 fragments of anti-blood group antibodies" |
anti-blood group antibody Date: 2007-10-01 see replies reply " can any company supply anti-blood group antibody" |
AU1 tag antibody Biotin conjugated Date: 2007-09-24 see replies reply "I need AU1 tag antibody Biotin conjugated! Does anyone besides Abcam offer this product?
" |
Alternative to AB1950 against fibronectin receptor CD49e/CD29 Date: 2007-09-19 see replies reply " Chemicon used to sell a goat polyclonal antibody agaist integrin alpha5beta1 under catalog number AB1950. This product was discontinued, I wonder if the same antibody is sold under a different name by other suppliers. If yes, could you please contact me? I need about 1 ml (10 vials like that of Chemicon).
Thanks" |
ab for detecting dog plasma cells (cd 138) and neutrophil granolycytes for immunohistochemistry. Date: 2007-09-17 see replies reply " I am looking for ab for formalin/paraffin tissue from dog for immunohistochemistry. Plasma cells (cd 138) and neutrophil granolycytes are the cells to be detected." |
scleraxis antibody Date: 2007-09-16 see replies reply " I need a scleraxis AB (anti human) for imunohistological stainings.
Could you give me more informations, please?
Sincerely yours" |
slr1208 antibody Date: 2007-09-10 reply "I'm looking for the slr1208-antibody usable for western-blotting to proceed in my PhD-Thesis! Thank you!! B. Forberich/ Germany" |
LRRFIP2 antibody Date: 2007-09-07 see replies reply " I am looking for an antibody for LRRFIP2 that I can use for IHC, Co-IPs and Western botting" |
antibodies against Aeromonas, diuron, bromacil, dichlobenzil, N-nitrosodimethylamine and RNA phages Date: 2007-09-05 see replies reply " I am looking for antibodies against Aeromonas, diuron, bromacil, dichlobenzil, N-nitrosodimethylamine and RNA phages" |
Primary antibodies for direct staining of paraffin embedded tissue sections Date: 2007-09-03 see replies reply " I need Flourescent labelled primary antibodies for paraffin embedded tissue mainly CD4, CD8, CD68, Foxp3, Granzyme B,perforin, DC specific antibodies" |
P2X4 Date: 2007-08-29 see replies reply " Any and all information that I can get on P2X4 (human and rat). Thank you" |
primaquine metabolite Date: 2007-08-20 reply "i have required two chemical-
1. carboxy primaquine.
2. 6-metoxy primaquine.
can u give some information,
" |
NRBF2 antibody Date: 2007-08-17 reply " we try to find NRBF2 antibody for western." |
recombinant mouse TLR11 protein Date: 2007-08-10 reply " For experimental need, I try to seek for recombinant mouse TLR11 protein. I lodgined the ExactAntigen website and found some information about it. Would you like to provide me more information about TLR11 protein or containing TLR11 plasmid. Your help will be appreciated." |
Botryococcus braunii Date: 2007-08-09 reply " I need Botryococcus braunii strain for experiments.Any subtype of strain is ok for me.KIndly let me know the rates." |
Mouse Ani MLH1 antibody Date: 2007-08-09 see replies reply " Mouse Ani MLH1 Clone no:ZM001. " |
positive control for monoclonal anti-mouse TLR4 Date: 2007-08-08 see replies reply " what positive control can i use by western blot to detect mouse TLR4 , my first antibody is monoclonal anti-mouse TLR4 " |
karanjin Date: 2007-08-08 see replies reply " karanjin" |
antibody against at3g23800 Date: 2007-08-07 reply " i need the antibody against at3g23800 encoded protein." |
Rhodobacterium sphaeroides Date: 2007-08-05 see replies reply "I am looking for Rhodobacterium sphaeroides. I will be buying 6 kgs to begin with. If you can supply it, please let me know your CIF detroit michigan price and specifications." |
anti-human CD138 for flow not raised in mouse Date: 2007-07-31 see replies reply "I need an antibody against human CD138 (Syndecan-1) raised in any organism other than mouse, suitable for flow cytometry. Ideally, the antibody would be conjugated to FITC or PE." |
THRAP3 protein information Date: 2007-07-30 reply " i need information about expression of THRAP3 protein.
" |
B220/CD45RA/CD45R Date: 2007-07-30 see replies reply "Looking for anti CD45RA/B220/CD45R Abs others than the commonly used ratIgG2a anti mouse B220/CD45RA (clone RA3-6B2). Also some clarifying info regarding CD45R/CD45RA/B220 mouse and human (who is who???, are they exactly the same thing??) will be appreciated" |
TFF2 antibody Date: 2007-07-26 see replies reply " Antibody to trefoil factor 2 (TFF2), also called SPEM" |
Ebixia amp Date: 2007-07-26 reply " I'm looking for a supplier of Ebixia amp for 10000 pcs. " |
acetyl coA carboxylase 1 and acetyl coA carboxylase 2 antibody Date: 2007-07-19 reply " i would like to get a monoclonal and polyclonal antibody for acetyl coA carboxylase 1 and acetyl coA carboxylase 2 with conjugate as horse radish peroxidase." |
mouse Eftud1 antibody Date: 2007-07-16 reply " I am looking for an Eftud1 antibody against the mouse protein. I have been unable to find anything and was wondering if you could offer any help.
Thanks a lot
Jacob" |
carpaine Date: 2007-07-10 reply " I need carpaine for analysis its content in papaya." |
60S acidic ribosomal protein P1, 40S ribosomal protein S12, Vacuolar ATP Synthase Subunit B, Enolase, Plasmepsin 1V Chain B, Proteosome Subunit Alpha Type 5 Date: 2007-07-04 see replies reply " I'm looking for antibody:
1. 60S acidic ribosomal protein P1, putative
2. 40S ribosomal protein S12 putative
3. Vacuolar ATP Synthase Subunit B
4. Enolase
5. Plasmepsin 1V Chain B
6. Proteosome Subunit Alpha Type 5" |
neuropilin-1 antibody for Facs test Date: 2007-07-02 reply " I need anti-mouse neuropilin-1 antibody for Facs test, it's better to be a fluorescence labeled one." |
neuropilin-1 antibody for FACS Date: 2007-07-02 see replies reply " I need anti-mouse neuropilin-1 antibody for FACS test.it's better to be a derect fluorescence labled one。 thanks!" |
calicheamicin Date: 2007-06-28 reply " I am looking for someone able to supply calicheamicin in g quantities. Please contact me if you sell it.
Thanks" |
KIAA2019 (C14orf78) Antibody/Information Date: 2007-06-26 reply "I need to find an Antibody to protein: KIAA2019 (C14orf78) that works in rat and in western blots. I also need information on molecular weight and possible lower molecular weight forms of this protein (cleavage products)" |
rfVIIa Date: 2007-06-26 reply " Hello,
I am trying to puchase or get purchasing information on rfVIIa" |
Slc37a2 blocking antibody Date: 2007-06-19 reply " I would like to find a blocqking antibody against Slc37a2" |
Myoferlin antibody Date: 2007-06-18 reply " An antibody to "Myoferlin" that works in western blots and is reactive in RAT. " |
GLUCOGAN Date: 2007-06-07 reply " AVAILABILITY OF DRUG GLUCOGAN IN MUMBAI / INDIA" |
Growth Factors, Hormones, Chemokines Date: 2007-06-06 reply " I would like to know where I can purchase commercial diagnostic kits for CCL23delta24(MPIF-1) AND HUMAN IGFR-2,FGFR2 and Leukotactin." |
Growth Factors, Hormones, Chemokines Date: 2007-06-06 reply " I would like to know where I can purchase commercial diagnostic kits for CCL23delta24(MPIF-1) AND HUMAN IGFR-2,FGFR2 and Leukotactin." |
PCDH12 Ab Date: 2007-06-05 see replies reply " Hi - I would like to find an any antibody against Protocadherin12 (VE-cadherin 2). Thanks" |
antibodies against GFP and 17-beta estradiol Date: 2007-06-04 see replies reply "I need information about anti antibodies against GFP and 17-beta estradiol and about the function of CD3zeta . Thank you ." |
CEA from cancer sources Date: 2007-05-30 see replies reply " I am searching for purified CEA antigen derived from cancerous specimens that include ovarian cancer, breast cancer, stomach cancer, pancreatic, etc., not just colorectal cancer or liver metastases." |
genipin Date: 2007-05-29 see replies reply " trying to purchase genipin" |
oxymorphine Date: 2007-05-29 reply " looking for oxymorphine,hydromorphine, or liquid morphine. in constant pain, causing me to be bed ridden, and losing any hope for releif " |
DISOPYRAMIDE Date: 2007-05-25 see replies reply "DISOPYRAMIDE 100mg, quantity 300 tablets. To be sent to Pakistan. " |
dichloroacetate Date: 2007-05-23 see replies reply " looking for dichloroacetate" |
pure moniliformin Date: 2007-05-17 see replies reply "I seek pure Bafilomycin A1, 1 mg, at reasonable price please. We are poor students and do not type money" |
pure moniliformin Date: 2007-05-17 reply "I seek pure moniliformin, 10 mg" |
Allatostatin 1 Date: 2007-05-10 reply "Allatostatin 1 extracted from drosophila" |
LISURIDE Date: 2007-05-09 reply " ONE KG LISURIDE CIF CAIRO,EGYPT" |
Corglycon 0.06% 1 ml/Convallotoxin Date: 2007-05-04 reply "We wish to know what will be equivalent quantity of Convallotoxin to and injection "Corglycon 0.06% 1 ml" which is used in Russian parts for managing cardiac failures. We need convallotoxin also. Kindly write us to "resources@akritigroup.com" and or "suneelvdurve@yahoo.com" Thank you We need convallotoxin. If you can supply this material, kindly write to us" |
antibodies to human and mouse Rab3GAP1 and Rab3GAP2 Date: 2007-05-01 reply "Please could anyone tell me wthether there are commercially available antibodies to human and mouse Rab3GAP1 (Uniprot/SWISSPROT;Acc:Q15042)and Rab3GAP2 Uniprot/SWISSPROT;Acc:Q9H2M9" |
chromobacterium violaceum antibody Date: 2007-04-26 reply " Any antibodies against proteins found in chromobacterium violaceum.
Any crude protein extracts from c. violaceum." |
chromobacterium violaceum antibodies and protein extracts Date: 2007-04-26 reply " Any antibodies against proteins found in chromobacterium violaceum.
Any crude protein extracts from c. violaceum." |
isopulegon Date: 2007-04-24 see replies reply " I am looking for isopulegon, quantity around 1 gr for testing in laboratory." |
ZNF80 antibody Date: 2007-04-23 reply " antibody to ZNF80" |
antibody for the actual Translocon protein Date: 2007-04-23 see replies reply " Is an antibody for the actual Translocon protein available?" |
antimullarian antibody kit Date: 2007-04-21 see replies reply " Please inform about antimullarian antibody kit to be used as marker for Sertoli cells (rodent. If you dont have kindly tell me from where it can be get
Uzair" |
MS Polyphenolic standards Date: 2007-04-17 reply " I am looking for standard materials for clovamide, deoxyclovamide and quercetin arabinoside" |
Carboxymethyl lysine Date: 2007-04-12 reply " I need carboxymethyl lysine modified protein for immunization and antibody purification." |
ZNF331 antibody Date: 2007-04-10 see replies reply " I would like to request for product information from the supplier on the ZNF331 antibody. Also, please provide me with a price information as well as stock status.
" |
monoclonal or ployclonal antibody using human Date: 2007-04-05 see replies reply " I need some antibody informations against identified proteins from mass spectrometry." |
Hexokinase 4 protein Date: 2007-03-29 reply " I'm looking for human Hexokinase 4 protein. Thanks" |
Phosphopyruvate hydratase Date: 2007-03-27 see replies reply " I'm trying to locate a supplier for "Phosphopyruvate hydratase" Enolase from baker's yeast - this material has been on backorder status w/Sigma for months.
Thank you!!!" |
Vasorin Antibody and ELISA kit Date: 2007-03-26 see replies reply "Human vasorin ELISA kit
Rat Vasorin Antibody and ELISA kit" |
HIG2 antibody Date: 2007-03-21 see replies reply "I need HIG2 antibody (hypoxia-inducible protein 2)
Strange, nobody has it." |
Pharmaceutical Complexes Date: 2007-03-19 see replies reply " Hi! We are one of the largest pharmaceutical companies with global presence and are looking at sourcing Nicotine Complexes and Hexitidine in bulk quantities for our European plant. Please reply to us as soon as possible if you manufacture any/ both of these products and can supply to European market." |
anaplasma phagocytophilum antibodies Date: 2007-03-09 reply " Anaplasma phagocytophilum monoclonal or polyclonal antibodies for immunehisto chemistry on sheep tissue." |
col4A3, xenopus antibody Date: 2007-03-01 reply " col4A3, xenopus" |
galactokinase 1 Date: 2007-02-28 reply " i need antibodies aginst yeast galactokinase 1" |
murine Sdf2l1 (stromal cell-derived factor 2 like 1) antibody Date: 2007-02-15 reply "I need antibodies against murine stromal cell-derived factor 2 like 1 (Sdf2l1). " |
Valacidin, rufocromomycin, streptonigrin, CAS 3930-19-6 Date: 2007-02-06 reply "Dear Mrs, Mr,
I am Ms CHENE from DIATOS SA Company (France) and I would like purchase a batch of 100 mg or 1 gram of Valacidin (=rufocromomycin, =streptonigrin, CAS 3930-19-6) (purity superior than 95%) Could you please give me a quotation for the both quantities and inform me on the delay concerning the product delivery.
Thank you very much.
" |
dichloroactetate Date: 2007-02-05 see replies reply "price and availability needed on:
dichloroactetate" |
Growth promoter Date: 2007-01-31 see replies reply " I want to know the suppliers & Price of N6-Benzyladenine" |
anti-UVRAG antibody Date: 2007-01-29 reply " A source for anti-UVRAG antibody " |
ATP2C Ca-ATPase antibody Date: 2007-01-29 reply " I need an antibody towards the ATP2C Ca-ATPase from human" |
Dichloroacetate Date: 2007-01-25 see replies reply " I would like to obtain pharmaceutical grade Dichloroacetate. Who is currently producing it?
Avrum Bluming, MD" |
anti VAChT or anti CHT1 antibody Date: 2007-01-23 reply " I need an antibody that labels cholinergic neurons in zebrafish (e.g. anti-VAChT, anti-CHT1)" |
OATPB antibody Date: 2007-01-22 reply " I need an antibody that detects human OATPB (OATP2B1) that can be used for western blotting." |
equine hemoglobin antibody Date: 2007-01-21 reply " I am in need of antihemoglobin antibody that has reactivity with equine hemoglobin. either polyclonal or monoclonal will do. " |
Dichloroacetate Date: 2007-01-18 see replies reply " Pharmaceutical Grade Dichloroacetate suppliers please" |
staining and diagnosis of Encephalitozoon cuniculi Date: 2007-01-14 see replies reply " Encephalitozoon cuniculi differential diagnosis in rat brain specimen" |
antigen chikungunya and antigen DBD Date: 2006-12-26 reply " Our campany is looking for tests for chikungunya antigen and DBD antigen , is there any company that sell this product in Indonesia ?" |
chikungunya antigen and DBD antigen Date: 2006-12-26 reply " Our campany is looking for tests for chikungunya antigen and DBD antigen , is there any company that sell this product in Indonesia ?" |
Silicone rubber of very low durometer reading. Date: 2006-12-20 reply " I am looking for a silicone rubber ( at least I think ) to be used in a medical model that has a very very low durometer reading but still has good tensile strength. " |
Human growth hormone protein Date: 2006-12-20 see replies reply " I need to get Human growth hormone protein with agood grade of purity." |
4-acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic acid Date: 2006-12-12 see replies reply " hi,
I neeed 4-acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic acid, if you have please contact me with your price Thanks
Anbu" |
SLC4a11 antibody Date: 2006-12-08 reply "SLC4a11 antibody a sodium borate cotransporter" |
TINP1 antibody Date: 2006-12-03 reply " Hi,
I need an antibody against human TINP1, polyclonal is fine urgently.I need to order 2 vials of antibody.Antisera will work too." |
Anticol ; Esperal Date: 2006-12-03 see replies reply " I am looking for a supplier of "Anticol" or "Esperal" or something similar drugs these are drugs which help to stop to use alcohol. " |
GABA Antibody Date: 2006-11-21 see replies reply " I need to find a GABA-B Receptor 1 antibody made in something other than rabbit." |
Ab's against Abeta 1-40;1-42 that will react with rat brain tissue for western blot Date: 2006-11-07 reply " Need Ab's against Abeta 1-40;1-42 that will react with rat brain tissue for western blot determination. Takeda Co. may have it." |
telomestatin Date: 2006-11-03 see replies reply "I need telomestatin to inhibit telomerase activity in cancer cells. " |
Febuxostat, DVS-233,agomelatine and flurizan Date: 2006-11-03 reply " I am requesting Materieal Safety Data Sheets for the following clinical drugs,
(Febuxostat, DVS-233,agomelatine and flurizan. Thank You Kindly
" |
3-hydroxypropionaldehyde Date: 2006-10-28 reply " I am looking for 3-hydroxypropionaldehyde. If anybody is supplying pl. contact me regards," |
anti-NP antibody Date: 2006-10-19 see replies reply "I am looking for an antibody (of the IgM and/or IgG3 isotypes) that reacts against the hapten NP (= 4-Hydroxy-3-nitrophenylacetic) - which is an T-independent II antigen for B-lymphocytes- to be used as a standard for ELISA" |
litrature review of Alstonia boonei. Date: 2006-10-18 see replies reply " The litrature review of Alstonia boonei." |
3-aminoethylpyrazole Date: 2006-10-10 reply " 3-aminoethylpyrazole" |
FITC conjugated monoclonal antibodies for HLA A1, A2, A3, and A24 Date: 2006-09-28 see replies reply " I am looking for FITC conjugated monoclonal antibodies for HLA A1, A2, A3, and A24 " |
Vibrio spp. monoclonal antibody Date: 2006-09-26 reply " I need monoclonal antibody for Vibrio spp., except V.cholerae" |
shrimp antibodies Date: 2006-09-26 reply " i want monoclonal antibody for Vibrio harveyi,Vibrio splendidus,Vibrio alginolyticus,Vibrio parahaemolyticus and for viruses that infect shrimp" |
CDPK antibody Date: 2006-09-22 reply " antibody to CDPK" |
2-Aminopropionitrile Date: 2006-09-20 reply "We need 2-Aminopropionitrile -- 5kg.
Please mail us your lowest rates, CIF Mumbai by Air basis, along with C.O.A. and availability status. " |
Twist1 antibody Date: 2006-09-19 reply " Twist1 antibody suitable for immunohistochemistry" |
Hemoglobin powder Date: 2006-09-18 see replies reply " we are one of the largest pharmaceutical company based in Nigeria.please we will appreciate if you can supply us Hemoglobin powder for our urgent use.You can contact us on our email as soon as possible.
Thanks
Anne Erasmus" |
Hemoglobin powder Date: 2006-09-18 reply " we are one of the largest pharmaceutical company based in Nigeria.please we will appreciate if you can supply us Hemoglobin powder for our urgent use.You can contact us on our email as soon as possible.Thanks" |
svep1 antibody Date: 2006-09-18 reply " I am looking for an antibody against svep1." |
deltaN p63alfa Date: 2006-09-15 reply "I am very interested in buying deltaNp63alfa isotype for Western blotting, and would appreciate an e-mail if you are able to provide this isotype, or know how to get it from other dealers. " |
RNA helicase - purified active enzyme Date: 2006-09-13 reply "I am looking for a commercial source of purified, active RNA helicase (any species, any helicase) for validating a biochemical assay. Tags such as GST, 6-his, etc are OK as long as the enzyme is active in a strand-unwinding assay. Well-studied RNA helicases include eIF4A and Hepatitis C virus NS3-helicase, but I have not been able to find a supplier of ACTIVE protein for either of these." |
Zeranol Date: 2006-09-13 see replies reply " I am looking for a supplier of "Zeranol", to use as a reference standard, a small quantity approx. 10g would by enough for the purpose of analysis. I need this standard to be certified by the supplier, preferably purity >95% and confirmation of identity. Can you be of any assisrtance?" |
Guronsan C Date: 2006-09-12 reply " I just want to know what this product does as it is in a formulation called Guronsan C. Includes Vit C plus glucuronamide plus glucuronolactone. What is its function??" |
ECM1 antibody Date: 2006-09-11 reply "Hello!
Do you have ECM1-antibody? A professor told me your company had the product,but I can not view your website,can you E-mail me related information about it?
I want it eagerly!
Yours Lei " |
PDE4 inhibitor Date: 2006-09-11 reply "Would anyone be so kind to tell me a supplier for piclamilast (RP 73-401)? Thank you! " |
Thermo DNA Ligase Date: 2006-09-08 see replies reply " Dear Sir/Madam,
I am writing from Latvian Genome Centre concerning your products. Since we
do not have the local distributors in Latvia, I would like to know if it
is possible to order Thermo DNA Ligase directly from you.
" |
Tipin antibody Date: 2006-09-07 reply " I am looking for a mono- or polyclonal ab to the human Tipin protein" |
Dia3 antibody Date: 2006-09-05 reply "Is it available human specific Dia3 antibody except from Abnova company?" |
dnajc1 antibody Date: 2006-09-05 reply " dnajc1" |
bulk chemical Date: 2006-09-02 reply " Looking for 3-hydroxypropional (3-hydroxypropionaldehyde); 3-Hydroxybutyraldehyde; 3-hydroxypentanal, as bulk supply." |
Endoproteinase Lys-C (EC 3.4.24.33/ CasNo 55576-49-3) and Endoproteinase Asp-N (EC 3.4.21.50/CasNo 123175-82-6) Date: 2006-08-30 see replies reply "Dear Sir or Madame,
The Roche Diagnostics GmbH from Germany is interested in the two enzymes Endoproteinase Lys-C (EC 3.4.24.33/ CasNo 55576-49-3) and Endoproteinase Asp-N (EC 3.4.21.50/CasNo 123175-82-6)
Please answer the following questions:
1. Are the two Enzymes also available as recombinant enzymes?
2. What about the quality? We would prefer "sequenzing grade"
3. Are the Enzymes generated under GMP conditions? Or are there different qualities?
4. What is the specific activity? Which substrat was used for testing the enzymes?
5. What was the temperature for the enzyme testing?
6.Please quote for scaled prices for 1gramm of the enzymes for the different qualities (if there are different qualities)?
7.Is your company the producer or only distributor of the enzymes?
Thank you very much in advance for your help!
I`m looking forward to hearing from you! " |
anserine Date: 2006-08-29 reply " looking for price for anserine would be looking for kilo prices. regards phil appel." |
Calotropin Date: 2006-08-23 reply " synthetic Supply of Calotropin - a glycoside for research work in Indian Council of Medical Research lab." |
Arabidopsis Anti-Fd-GOGAT Date: 2006-08-19 reply "Arabidopsis Anti-Fd-GOGAT" |
C6B antibody Date: 2006-07-31 reply " C6B antibody, " |
Ntcp antibody and siRNA Date: 2006-07-31 see replies reply " I need antibody and siRNA to rat Ntcp(of course ones that really work!) Also looking for siRNA to rat BSEP as well." |
CD320 antibodies Date: 2006-07-24 reply " need antibodies to CD320" |
antigens- proteins glycophorin A-CD235A, and CD71 Date: 2006-07-18 see replies reply " antigens in quantities of 1mg immediately, more in future - recombinant proteins: glycophorin A, also called CD235A, and CD71 preferably the intact transmembrane protein." |
anti-ArcA antibody Date: 2006-07-18 see replies reply " I am looking for antibodies against the E. coli ArcA protein (ecs5359) or the ArcA protein from another bacterial species. Please contact me if you are aware of any source of this antibody." |
E-cadherin antibody Date: 2006-07-18 see replies reply " Polyclonal antibody, Rabbit anti-human E-cadherin, purified, usable for immunohistochemistry. " |
ELISA Antigen for Encephalitozoon cuniculi Date: 2006-06-28 reply "ELISA Antigen for Encephalitozoon cuniculi " |
DUS2 antibody Date: 2006-06-28 reply " Looking for antibody against DUS2 (human): dihydrouridine synthase" |
citrobacter freundii Date: 2006-06-24 see replies reply " Citrobacter freundii + metabolism + characteristic" |
Atm1 antbody Date: 2006-06-20 see replies reply " Dear Sir/madam, Please send me a quotation for a Atm1 antbody including all the details. Thanks. Best regards." |
fucoidin Date: 2006-06-19 reply " I am looking for a source of fucoidin as a health supplement. I am not a doctor. Sources generally avilable to the public are expensive and the actual amount of fucoidin is not specified. I would like to know what source is used for the many studies done. Thank you." |
pythium oligandrum Date: 2006-06-18 reply " biology.ecology,identification to mycoparasitic pythium sp. specialy pythium oligandrum" |
human oncostatin M receptor and mouse leukemia inhibitory factor receptor antibody Date: 2006-06-12 see replies reply " I need an antibody directed against mouse leukemia inhibitory factor receptor (mLIFRbeta)& an antibody directed against human oncostatin M receptor (hOncostatin M receptor beta; favourably working in Western Blots; crossreactivity within species wellcome" |
antibody against RGD from the integrin binding peptide Date: 2006-06-11 see replies reply "I am looking for an antibody against RGD from the integrin binding peptide. Thanks." |
myocardin antibody (anti-human) Date: 2006-06-08 see replies reply " I need an antibody against human myocardin for detection with western blotting." |
Murine gammaherpesvirus 68 antibodies Date: 2006-06-08 see replies reply " I need IHC or Western blot antibodies for Murine gammaherpesvirus 68, and specifically for the MHV68 v-cyclin. Thanks!" |
CCR7 siRNA Date: 2006-06-02 see replies reply "Dear sir or madam,
I am going to do some research about CCR7. There is CCR7 siRNA human in your product list, however, I can't find any information in detail about this product on your website. Could you please tell me a reagent provider of CCR7 siRNA human?
" |